KEGG   Xylanimonas cellulosilytica: Xcel_1550Help
Entry
Xcel_1550         CDS       T01135                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_1550
   01230 Biosynthesis of amino acids
    Xcel_1550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_1550
   00051 Fructose and mannose metabolism
    Xcel_1550
   00562 Inositol phosphate metabolism
    Xcel_1550
Enzymes [BR:xce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Xcel_1550
Exosome [BR:xce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Xcel_1550
  Exosomal proteins of bladder cancer cells
   Xcel_1550
  Exosomal proteins of melanoma cells
   Xcel_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1689778..1690563
Genome map
AA seq 261 aa AA seqDB search
MTTRTPLMAGNWKMNLDHQEAIATVQKLAWTLKDAKHDPASVEVVVCAPFTDLRSVQTLV
DGDKLDVKYAAQDVSQHASGAYTGEISAAMLAKLGCAYVVVGHSERREYHGESDALVNAK
VKAAFGQGITPILCVGEGLDVRKAGDQVSYTLAQVEAGLAGLTAEQATTIVIAYEPVWAI
GTGEVATPEDAQEVCGAIRGLLARLYDDEVAAATRVLYGGSVKSSNVADIMAKPDVDGAL
VGGASLDPAEFAKIVRYQAHA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcgcaccccgctcatggcgggcaactggaagatgaacctggaccaccaggag
gccatcgccaccgtccagaagcttgcctggacgctcaaggacgccaagcacgaccccgct
tcggtcgaggtcgtcgtctgcgcgccgttcacggacctgcgctcggtgcagaccctggtc
gacggtgacaagctcgacgtcaagtacgccgcgcaggacgtctcgcagcacgcgtcgggc
gcctacaccggcgagatctccgcggcgatgctcgcgaagctcggctgcgcctacgtcgtc
gtcgggcactcggagcgccgggagtaccacggcgagtccgacgcgctggtcaacgccaag
gtgaaggcagcgttcggccagggcatcacgccgatcctgtgcgtcggcgagggcctggac
gtccgcaaggcgggcgaccaggtctcctacacgctcgcgcaggtcgaggcaggcctcgcc
gggctcaccgccgagcaggccacgaccatcgtcatcgcctacgagcccgtctgggccatc
ggcaccggcgaggtcgccacccccgaggacgcgcaggaggtctgcggcgcgatccgcggc
ctgctcgcccgcctgtacgacgacgaggtcgccgcggcgacccgcgtcctgtacggcggt
tcggtgaagtcgtccaacgtcgccgacatcatggcgaagccggacgtcgacggcgccctc
gtgggcggcgcgagcctcgaccccgcggagttcgcgaagatcgtgcgctaccaggctcac
gcctga

DBGET integrated database retrieval system