KEGG   Xylanimonas cellulosilytica: Xcel_1667Help
Entry
Xcel_1667         CDS       T01135                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xce03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1805008..1805631
Genome map
AA seq 207 aa AA seqDB search
MIASLTGVVEHVSLDRAVIDVGGVGYLVHATPGTLAGLRTGERARLFTTMVVREESMTLY
AFTDDDERALFETAQSVSGVGPRIALAVLAVHTPDAVRRAVHTQDVKALTRVPGIGPKVA
QRILLELGGKLGAPTGDGAAGSGATAGTGGDQRGKVVEALVGLGYPAKTADDAVARVLAD
GGTETVADADVAATLRATLRMMGGRRG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgtcgctgaccggggtcgtggagcacgtctcgctcgaccgggccgtgatcgac
gtcggcggcgtcggctacctcgtgcacgcgacccccggcacgctggccgggctgcgcacg
ggcgagagggcgcgcctgttcaccacgatggtggtgcgcgaggagtccatgaccctgtac
gcgttcaccgacgacgacgagcgcgcgctcttcgagaccgcgcagtccgtctccggggtc
ggcccgcgcattgcgctcgccgtcctcgcggtgcacacgcccgacgccgtccgccgcgcc
gtgcacacgcaggacgtcaaggcgctgacgcgggtcccgggcatcggcccgaaggtcgcc
cagcgcatcctcctggagctcggcggcaagctcggggcaccgacgggcgacggcgccgcc
ggctccggtgcgaccgccgggacggggggcgaccagcgcgggaaggtggtcgaggcgctg
gtcgggctcggctaccccgcgaagaccgccgacgacgccgtcgcgcgcgtgctggcggac
gggggcacggagacggtcgccgacgccgacgtcgccgccaccctgcgtgcgaccctgcgg
atgatgggcggacgccgtggctga

DBGET integrated database retrieval system