KEGG   Xylanimonas cellulosilytica: Xcel_1794Help
Entry
Xcel_1794         CDS       T01135                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Xcel_1794
   00052 Galactose metabolism
    Xcel_1794
   00500 Starch and sucrose metabolism
    Xcel_1794
   00520 Amino sugar and nucleotide sugar metabolism
    Xcel_1794
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Xcel_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1928627..1930021)
Genome map
AA seq 464 aa AA seqDB search
MTDTGLQQAREKMTAAGVAPAAIETFTRFYGLLESGVSGLVREDDVDPLPQLARADALGL
SDDDAAAALAKTAIIKLNGGLGTSMGMDKAKSLLPVRGELTFLDVIVGQVRAARASTGTR
LPLILMNSFRTQDDTLALLGRYDDVAVDGLPLDFLQNREPKLRADDLTPVEWPADPDLEW
CPPGHGDLYPALHAGGVVRALLDAGFRYASVSNSDNLGAAPDARIAGWFAASGAPYAAEM
CLKTPADVKGGQLVVRKADGRIVQRETAQTHPDDVAVSLDPARHRYFHTNNLWFDLEALA
AELDRTGGVLELPLIRNDKTVDPADPASTPVVQIESAMGAAVAVFEGATAIEVGRERFLP
VKTTNDLLVLRSDVYALTDDFRVVAQVPAPLVSLSKAYKTIAGFDARFPAGPPSLREATA
LTVDGDWTFGADVRVQGDAVLPDAGSPSVVPDGAAVTADGVVAG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccggcctgcagcaggcacgcgagaagatgacggccgcgggcgtggcgccc
gccgcgatcgagacgttcacccggttctacgggctcctggagtccggagtgtcgggcctg
gtccgcgaggacgacgtcgaccccctgccgcagctcgcccgggcggacgctctcgggctg
tccgacgacgacgcggccgccgcgctggcgaagacggcgatcatcaagctcaacggtggc
ctgggcacctcgatgggcatggacaaggccaagtcgctgctgccggtccgcggcgagctc
acgttcctcgacgtcatcgtcggccaggtgcgtgcggcccgggcctccaccgggacgcgc
ctgccgctgatcctcatgaactcgttccgcacgcaggacgacacgctcgcgctgctgggc
cggtacgacgacgtcgccgtcgacgggctgccgctggacttcctgcagaaccgcgagccc
aagctgcgggccgacgacctgacgcccgtcgagtggcccgccgacccggacctggagtgg
tgcccgcccggccacggggacctgtaccccgcactgcacgcaggcggcgtcgtgcgcgcg
ctgctggacgccgggttccggtacgcgagcgtgtccaactcggacaacctcggcgccgcc
cccgacgcccgcatcgcgggctggttcgcggcgtcaggcgccccgtacgcggcggagatg
tgcctcaagacgcccgcggacgtcaagggcggccagctcgtggtccgcaaggccgacggc
cggatcgtgcagcgtgagaccgcgcagacgcaccccgacgacgtcgccgtgtcgctcgac
ccggcacggcaccgctacttccacacgaacaacctgtggttcgacctggaggcgctggcc
gccgagctggaccggaccgggggagtgctggagctgccgctgatccgcaacgacaagacc
gtcgacccggcggaccctgcctcgaccccggtcgtgcagatcgagtccgcgatgggtgcc
gccgtcgccgtcttcgagggggctaccgcgatcgaggtgggccgcgagcggttcctgccc
gtcaagaccaccaacgacctgctggtgctgcgctcggacgtgtacgccctcaccgacgac
ttccgggtcgtggcgcaggtgcccgccccgctggtgtcgctcagcaaggcctacaagacg
atcgccgggttcgatgctcgcttcccggccggtccgccctcgctgcgcgaggcgacggcg
ctgacggtcgacggcgactggacgttcggcgccgacgtgcgggtgcagggagacgccgtg
ctccccgacgccgggagcccgtcggtggtgccggacggcgcagcggtcacggcggacggc
gtcgtcgccggctga

DBGET integrated database retrieval system