KEGG   Xylanimonas cellulosilytica: Xcel_1813Help
Entry
Xcel_1813         CDS       T01135                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Xcel_1813
Enzymes [BR:xce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Xcel_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1951313..1952497)
Genome map
AA seq 394 aa AA seqDB search
MTHDAAGTHAPLVAEGRPLTPVMAGATVLITADRRSGELAAALERRGARVRHAPALSIVP
HVDDQALIAATRTLLAAPPDVLVATTGVGFRAWVEAADAYGVADELRTALAGTRIVARGP
KANGAIQAAGYRADWVAESETSAEVAELLLSEGVAGLHVAVQQHGAGADGLDVVLEKAGA
RVTNLVVYRWGPPPDPAALADSARAAAAGEIDAVVFTSAPGAEAWLAAVEDAGYGPRVVE
RFTFGQMVAAAVGPVTARPLQHRGITPLQPERGRLGALVRSLVAHYTHVESVALATVAGP
LVVRARVAVLDGRVLPLSPTGVEVLRLLAAAGGAVVSRERVLDVLPGDSRDPHAVEVAIG
RVREAVGRRDLIRTVVKRGYRIEKAVESVVENVR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgacgccgctggcacgcacgccccgctcgtggctgaggggcgccctctgacg
cccgtgatggcgggtgccacggtgctcatcaccgccgaccggcgttcgggcgagctggcg
gcggcgctggagcggcgcggcgcccgcgtgcggcacgcgcccgcgctgagcatcgtcccg
cacgtggacgaccaggccctgatcgccgcgacccgcacgctgctcgccgcgccgcccgac
gtgctcgtggccaccacgggcgtggggttccgggcctgggtcgaggcggcggacgcctac
ggcgtcgcggacgagctccgcacggcgctggccggcacccgcatcgtggcccgcggtccc
aaggcgaacggtgccatccaggccgccgggtaccgggccgactgggtcgcggagtccgag
acgtccgccgaggtggccgagctgctgctctccgagggcgtggcagggctgcacgtggcc
gtccagcagcacggtgccggggccgacggcctcgacgtcgtgctggagaaggcgggcgcc
cgcgtgaccaacctcgtggtctaccgctggggtccgccaccagacccggccgcgctcgcc
gactcggcgcgggcggccgccgcgggcgagatcgacgcggtggtgttcacctccgcgccc
ggcgccgaggcgtggctggcggcggtcgaggacgccgggtacggcccgcgggtggtcgag
cggttcacgttcgggcagatggtcgccgccgccgtcggtcccgtcacggcccgtccgctg
cagcaccgcggcatcaccccgctgcagcccgagcggggccgcctgggcgccctggtgcgc
tcgctcgtggcgcactacacgcacgtcgagtccgtcgcgctggccaccgtggccgggccg
ctggtcgtccgggcgcgggtcgccgtgctcgacgggcgggtgctgcctctgtcgcccacg
ggcgtcgaggtgctgcgcctgctggccgccgcgggcggtgccgtcgtctcgcgcgagcgg
gtgctggacgtgctgccgggcgactcgcgcgacccgcacgccgtcgaggtggccatcggt
cgcgtgcgtgaggccgtgggccgccgcgacctcatccgcaccgtcgtcaagcgtggctac
cgcatcgagaaggccgtcgagagtgtcgtcgagaatgtccgctga

DBGET integrated database retrieval system