KEGG   Xylanimonas cellulosilytica: Xcel_2002Help
Entry
Xcel_2002         CDS       T01135                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00010  Glycolysis / Gluconeogenesis
xce00052  Galactose metabolism
xce00500  Starch and sucrose metabolism
xce00520  Amino sugar and nucleotide sugar metabolism
xce00521  Streptomycin biosynthesis
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01130  Biosynthesis of antibiotics
xce01200  Carbon metabolism
Module
xce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_2002
   00052 Galactose metabolism
    Xcel_2002
   00500 Starch and sucrose metabolism
    Xcel_2002
   00520 Amino sugar and nucleotide sugar metabolism
    Xcel_2002
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Xcel_2002
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Xcel_2002
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Xcel_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N BcrAD_BadFG FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ACZ31021
JGI: Xcel_2002
UniProt: D1BTP2
Position
complement(2159339..2160283)
Genome map
AA seq 314 aa AA seqDB search
MHAIGVDIGGTKIAIGVVDTDGRILAQVRVETNPDDVGSIDRAIADACNALAKEHEVGAI
GVAAAGFVSSDRTTMAFAPNIAWRDYPLGTRIAALVDLDVPVVVENDANAAGWAEFRFGA
GRDAADMLMLTIGTGLGGAVVVDGNLVRGRWGVAAEVGHMRVVPGGHYCGCGHEGCWEQY
ASGSALVRDAKAAVVALPHKAGRLLELAGGDRKKLKGPHVTQAAQEGDELAVALVAKLGR
WIGEGAASVAALLDPELIVVGGGVAAAGDLLLLPAREGFESQLSALGHRPVARIELAEQG
NEAGIVGAADLARR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgatcggcgtcgacatcggtggtacgaagatcgccatcggcgtcgtggacacc
gacgggcggatcctcgcccaggtccgggtcgagaccaaccccgacgacgtcgggagcatc
gaccgcgcgatcgccgacgcctgcaacgcgctggcgaaggagcacgaggtgggcgcgatc
ggcgtcgccgccgccgggttcgtgagctccgaccgcaccaccatggcgttcgccccgaac
atcgcgtggcgggactacccgctgggcacccggatcgccgcgctcgttgacctcgacgta
ccggtcgtcgtcgagaacgacgccaacgcggccggctgggccgagttccggttcggcgcg
ggccgggacgcggccgacatgctcatgctgaccatcggcaccgggctgggcggcgccgtc
gtcgtcgacggcaacctggtgcgcgggcgctggggcgtcgcggccgaggtcggccacatg
cgcgtggtgcccggcgggcactactgcgggtgcggtcacgagggctgctgggagcagtac
gcctccggcagcgcgctggtgcgtgacgccaaggcagccgtcgtcgcgctgccgcacaag
gccgggcggctgctggagctcgccggcggcgaccgcaagaagctcaagggcccgcacgtc
acccaggccgcccaggaaggcgacgagctcgcggtcgcgctggtcgccaagctcgggcgc
tggatcggcgagggcgccgcgtccgtcgccgcgctgctcgacccggagctgatcgtcgtc
ggcggcggggtcgccgcggcgggcgacctgctgctcctgccggcacgggaggggttcgag
tcccagctctccgcgctcggtcaccggcccgtcgcgcgcatcgagctcgccgagcagggc
aacgaggccgggatcgtcggcgcggcggacctcgcccgccgctga

DBGET integrated database retrieval system