KEGG   Xylanimonas cellulosilytica: Xcel_2030Help
Entry
Xcel_2030         CDS       T01135                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_2030
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Xcel_2030
  Amino acid metabolism
   00310 Lysine degradation
    Xcel_2030
Enzymes [BR:xce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Xcel_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2186256..2188016
Genome map
AA seq 586 aa AA seqDB search
MSENVQLPALGESVTEGTVTRWLKQVGDTVAVDEPLLEVSTDKVDTEIPSPVAGVLEQIL
VNEDDTVEVGAVLAVIGDGSGAGDAPAAPAAESPAEPEPEPAPAEQPAAEAPKPAEQAPA
APAEAPAADVAPAPSGDGTEVTLPALGESVTEGTVTRWLKAVGDSVEVDEPLLEVSTDKV
DTEIPSPVAGTVQQILVNEDDTVEVGAVLAIVGSGAPAPAAPAPAPAAAPEPAPAAAPAP
APAAPAPAPAAAEPAPAPAPAAPAPAEPVAADGKSYLTPLVRKLAADKGVDLSTVVGTGV
GGRVRKEDVLAAAEKAAAPAPAEAPAAAAPAAKAPAAKTPTIPSPSPLRGTTEKMSRLRK
IVAERMVDALHTQAQLTTVVEVDVTKVAKLRAKAKEPFKAREGANLTFLPFYTLAAVEAL
KAFPKINASIDQEKGEITYHASENIGIAVDTERGLVVPVVKNAGDLNLAGLARQIGDLGA
RTRANKVGPDELSGATFTITNTGSGGALIDTPIVPGGQVAILGTGTITKKPAVITVDGEE
VIAIRQFAYLFLSYDHRLVDGADAARFLTAIKARIEEGAFEAEVGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaacgtgcagctgcccgccctgggcgagtccgtcaccgagggcaccgtcacc
cgctggctcaagcaggtcggtgacaccgtcgccgtggacgagccgctgctcgaggtctcc
acggacaaggtcgacaccgagatcccctcgcccgtcgcgggggtgctcgagcagatcctc
gtgaacgaggacgacaccgtcgaggtgggcgccgtgctcgccgtcatcggcgacgggtcg
ggtgcgggcgacgccccggccgcgcccgccgccgagtctcccgccgagcccgagcccgag
cccgcccccgcggagcagcccgccgccgaggcccccaagcccgccgagcaggctccggcc
gcgcccgccgaggcccccgctgccgacgtcgcacccgctccctccggggacggcaccgag
gtcacgctccccgcgctcggtgagtcggtcaccgagggcaccgtcacccggtggctcaag
gccgtgggcgactccgtcgaggtcgacgagccgctgctcgaggtctccaccgacaaggtc
gacaccgagatcccgtcgcccgtcgcgggcaccgtgcagcagatcctcgtgaacgaggac
gacacggtcgaggtcggcgccgtgctggccatcgtcggttcgggtgcgcccgctccggcc
gcccctgccccggctcccgccgccgctcccgagcccgcaccggccgccgccccggcaccg
gcaccggcggctccggccccggcccccgccgcggcggagcccgccccggcaccggcaccg
gctgccccggcaccggccgagcccgtcgccgccgacgggaagtcctacctgacgccgctc
gtgcgcaagctcgccgcggacaagggcgtggacctgtccaccgtcgtcggcaccggtgtg
gggggtcgcgtccgcaaggaggacgtgctcgccgccgccgagaaggccgcggctccggcc
ccggccgaagcacccgcggccgccgccccggctgccaaggcgccggctgccaagaccccg
acgatcccgtcgccgtcgccgctgcgcggtaccacggagaagatgtcgcgcctgcgcaag
atcgtcgccgagcgcatggtcgacgccctgcacacgcaggcgcagctcaccaccgtggtc
gaggtggacgtcaccaaggtcgccaagctccgcgcgaaggccaaggagccgttcaaggcg
cgggagggcgcgaacctcaccttcctgcccttctacacgctggccgccgtcgaggcgctc
aaggcgttcccgaagatcaacgcctcgatcgaccaggagaagggcgagatcacctaccac
gcgtcggagaacatcggcatcgccgtcgacaccgagcgtggcctggtggtgccggtcgtc
aagaacgccggcgacctcaacctggccggcctggcccgccagatcggcgacctgggtgcc
cgcacccgcgccaacaaggtgggtccggacgagctgtcgggcgcgacgttcacgatcacc
aacacgggttcgggcggtgcgctcatcgacacgccgatcgtccccggcggtcaggtcgcg
atcctcggtaccggcacgatcaccaagaagccggcggtcatcacggtcgacggcgaggag
gtcatcgcgatccgccagttcgcgtacctgttcctctcctacgaccaccgcctggtcgac
ggcgccgacgcggcccgcttcctgacggcgatcaaggcccgcatcgaggaaggcgcgttc
gaggccgaggtcggcctctga

DBGET integrated database retrieval system