KEGG   Xylanimonas cellulosilytica: Xcel_2031Help
Entry
Xcel_2031         CDS       T01135                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
xce  Xylanimonas cellulosilytica
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2188086..2189867)
Genome map
AA seq 593 aa AA seqDB search
MTDHDYDVLVIGSGFGGSVAALRLTEKGYRVGVLEAGRRFADHEFASSSWHLRSFLWAPA
LRCFGIQRVRLLRDVLVLSGAGVGGGSLVYANTLYRPLGPFFADPAWAHLTDWKSELDSY
YDQAERMLGSVRFPGRTPADEVMEDVARQLGVGETFTPANVGVFFGPDGGQTPGRTAADP
FFGGAGPERTGCTQCGECMTGCRHGAKNTLVKNYLHLAEAAGAVVHPLTTVTAVVPVDDP
GATPDQHGGEHAGFVVETERTGRPGRGTRFTARQVVLAAGTLGTQTLLHQMRDAGTLPHL
SDRLGHLTRTNSEALLGASVPHRGPIGPDGRRDRSRQRPDYSRGVAITSSFYPDPATHVE
PVRYGHRSNAMGLLQTVLVDGGPARLRRWLAEVARLGTHLTDLLDLRRWSERTVIALVMQ
ARDNSLTTYTRRGLRGRRLTSRQGTGEPNPSWIPVAHDAVRRMAAAMGGRAGGSMGDPFD
IPMTAHILGGCTIGATASDGVIDPYHRVHGYPGLHVVDGSAVTANLGVNPSLTITAQAER
AFALWPNRGEPDPRPTPGSAYARVAPVAPLHPVVPASAPGALRLPLVEIRHTA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaccacgactacgacgtcctggtgatcggctcagggttcggcggttcggtcgcc
gccctgcgcctgaccgagaaggggtaccgcgtcggcgtgctggaggccggtcgacgcttc
gccgaccacgagttcgccagcagctcctggcacctgcgctcgttcctgtgggcgcccgcg
ctgcgctgcttcggcatccagcgggtccggctcctgcgggacgtgctggtgctctccggt
gccggggtgggcggcgggtcgctggtgtacgccaacacgctctaccgcccgctggggccg
ttcttcgcggacccggcctgggcgcacctgaccgactggaagtccgagctggactcgtac
tacgaccaggccgaacgcatgctcggatccgtgcggttccccggccgcacccccgccgac
gaggtcatggaggacgtcgcccggcagctcggcgtcggggagacgttcacgccggcgaac
gtcggggtgttcttcgggccggacggcggacagactcctgggcgcaccgccgccgacccg
ttctttggcggtgccggacccgagcggaccggctgcacgcagtgcggggagtgcatgacg
gggtgccgtcacggtgccaagaacacgctcgtcaagaactacctgcacctggccgaggcg
gcgggcgccgtcgtgcacccgctcacgaccgtcaccgccgtcgtccccgtcgacgacccg
ggcgccacccccgaccagcacggcggcgagcacgcggggttcgtcgtcgagaccgagcgc
accgggcggcccggccgcgggacgcggttcaccgcccggcaggtggtgctcgcggccggg
accctcgggacgcagaccctgctgcaccagatgcgcgacgcgggcaccctgccgcacctc
tcggaccggctcgggcacctgacccggaccaactccgaggcgctgctcggcgcctccgta
ccgcaccgcggcccgatcggccccgacgggcgccgcgaccgttcacggcagcggcccgac
tactcgcgcggcgtcgccatcacgtcctcgttctaccccgaccccgccacgcacgtggag
cccgtgcgctatgggcaccggtcgaacgcgatggggctgctgcagaccgtcctcgtcgac
ggcgggcccgctcgcctgcgccgatggctggccgaggtcgcccggctgggcacgcacctc
accgacctgctcgacctgcgccgctggtcggagcggaccgtcatcgccctggtgatgcag
gcgcgcgacaactcgctgacgacgtacacgcgccgcggcctgcgcggccgacggctgacg
tcacgccagggcaccggcgagccgaacccgtcgtggatccccgtcgcccacgacgcggtc
cggcggatggccgcggccatgggcgggcgtgcgggcgggtcgatgggcgacccgttcgac
atcccgatgacggcccacatcctcggcggctgcacgatcggcgcgacggcgtcggacggc
gtcatcgacccctaccaccgcgtgcacgggtatcccggcctgcacgtggtcgacggctcg
gcggtgaccgccaacctcggtgtcaacccgtcgctgacgatcaccgcgcaggccgagcgt
gcgttcgcgctgtggcccaaccgcggcgagccggacccgcgccccacgcccgggtcggcg
tacgcccgggtcgcgcccgtcgcgccgctccacccggtcgtcccggcgtcggcccccggg
gcgctccgcctgcccctggtggagatccggcacacggcctga

DBGET integrated database retrieval system