KEGG   Xylanimonas cellulosilytica: Xcel_2049Help
Entry
Xcel_2049         CDS       T01135                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00010  Glycolysis / Gluconeogenesis
xce00520  Amino sugar and nucleotide sugar metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01130  Biosynthesis of antibiotics
xce01200  Carbon metabolism
Module
xce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_2049
   00520 Amino sugar and nucleotide sugar metabolism
    Xcel_2049
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Xcel_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACZ31068
JGI: Xcel_2049
UniProt: D1BTT9
Position
2212409..2213185
Genome map
AA seq 258 aa AA seqDB search
MAQHLAFGIDIGGSGIKGAPVDLRTGEFAADRVRIPTPDQSTPDAVAKVLAELVGSFDLP
QEAPIGVAFPAPMDHGVVRFIANLDQSWKGVDLPALLHESTGHEVTAVNDADAAGISEQR
YGAAQGRDGTVLVVTLGTGIGSALIVDGVLVPNTELGHLEIDGFDAESRAADSAREREGL
DFPAWAGRLQRYFETVEMLLSPDLIVVGGGVSKKHAAFLPLLDLRATIIPAKLRNAAGIV
GAAAMAATEASKGHQRKH
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcacctcgccttcgggatcgacatcggcggatccggcatcaagggcgccccc
gtcgacctgcgcaccggagagttcgccgcggaccgggtccgcatcccgacgcccgaccag
agcacgcccgacgccgtcgcgaaggtcctggccgagctggtcggctcgttcgacctgccg
caggaggcgcccatcggcgtcgccttccccgctccgatggaccacggcgtcgtccggttc
atcgccaacctcgaccagtcgtggaagggcgtcgacctgcccgcgctgctgcacgagtcg
acggggcacgaggtgacggccgtcaacgacgccgacgccgccggcatcagcgaacagcgc
tacggcgccgcgcagggcagggacggcacggtgctggtggtcacgctcggcaccgggatc
ggctcggcgctcatcgtcgacggcgtcctggtgcccaacaccgagctcggccacctggag
atcgacgggttcgacgccgagtcgcgcgccgcggactctgcccgcgagcgcgagggtctc
gacttcccggcctgggccggccgcctgcagcgctacttcgagaccgtggagatgctgctg
tcgcccgacctcatcgtcgtcggcggcggggtgagcaagaagcacgcggcgttcctgccc
ctgctggacctgcgggccacgatcatccccgcgaagctgcgcaacgcggcgggcatcgtc
ggtgccgccgccatggcggccaccgaggcctccaagggccaccagcgcaagcactga

DBGET integrated database retrieval system