KEGG   Xylanimonas cellulosilytica: Xcel_2118Help
Entry
Xcel_2118         CDS       T01135                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Xcel_2118
  Lipid metabolism
   00561 Glycerolipid metabolism
    Xcel_2118
   00600 Sphingolipid metabolism
    Xcel_2118
Enzymes [BR:xce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Xcel_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2274528..2276693
Genome map
AA seq 721 aa AA seqDB search
MTTGTDGVVHLRAGGVSLVVETGGGLPRIVHWGEDLGDLDPSSVRAVATSSVPPVVSGPV
DEVVPLAVLPEAHRGWLGTPGLSGHRRGRHFAPAFVTAAVEAQTSDGGAQRLVTHARDDD
AALSLTVTIELAPSGLVSLDAALTNDHPTEPYQLDALLLALPVPTLATEIVDFTGRHLRE
RSPQRHRFTQGTHLRENRRGRTGADATTLLLAGTPSFSFESGEVWGVHVAWSGNHRTLAE
RSAEGQGVLAGGELLLPGELELAPGETYTSPTVYGAWGRGLNALSWRFHEYLRARPGHPS
ARRPVLLNTWEAVYFHQDVDALTQLADVAADVGIERFVLDDGWFRGRRDDTAGLGDWYVD
TDVWPQGLHPLVERVRERGMQFGLWFEPEMVNPDSDLARAHPEWILGPGPSLPPEARHQQ
VLDLADPDAFAYVLGRLDAVISEYDVDFVKWDHNRDLVAPGRGPRRTAGTHEQTLAVYRL
VDTLRERHPRLEIESCSSGGARVDLGILQRTDRVWASDSIDALERQHIERWTRLLLPPEL
VGSHIGSAWAAATGRTHELEMRAGTAFFGSLGIERDLRHADAEERAALQAWIALYQQHQE
LLHTGRFHTVDHGDPSLHVHGVVAQDQAEAIYSFVAVATSEYARPGLVRLPGLDPDVSYD
VRPVPLAARVEKFMGFTAPPWWADGITLPGSVLSRHGVQIPALFPERLTMVHVQRATAVA
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacggggaccgacggcgtcgtgcacctgcgcgcggggggagtctcgctcgtcgtc
gagacgggcggtgggctgccgcggatcgtgcactggggtgaggacctcggtgacctcgat
ccgtccagcgtgcgggccgtcgcgacgtcgtcggtcccacccgtggtctcgggcccggtg
gacgaggtcgtcccgctcgcggtgctgcccgaggcgcaccgcgggtggctgggcactcct
ggcctctccgggcaccgccgcggccggcacttcgcgccggccttcgtcaccgccgccgtc
gaggcacagacgtccgacggcggtgcgcagcggctggtcacgcatgcacgtgacgatgac
gcggcactctccctcacggtgacgatcgagctcgcgccgtccggcctcgtgtcgctcgac
gcagccctcaccaacgaccacccgacggagccgtaccagctggacgccctgctgctcgcg
ctccccgtgcccacgctcgcgacggagatcgtggacttcacgggacgccacctgcgggaa
cggtcgccgcagcggcaccggttcacccagggcacccatctgcgggagaaccgccggggt
cggaccggtgccgacgcgacgacgctgctcctcgccggcacgccgtccttctcgttcgag
tccggcgaggtgtggggcgtccacgtcgcgtggagcggcaaccatcgcacgctggccgag
cggagcgccgaggggcagggagtcctggccggcggggagctgctgctccccggcgagctg
gagctcgcccccggcgagacgtacacgtccccgaccgtgtacggcgcctgggggcgtggc
ctcaacgcgctctcgtggcggttccacgagtacctgcgcgcgcgcccgggccacccgagc
gcgcgccgcccggtactcctcaacacgtgggaggccgtctacttccaccaggacgtcgac
gctctcacgcagctcgcggacgtcgccgccgacgtcggcatcgagcggttcgtgctcgac
gacggctggttccggggccggcgcgacgacaccgcgggcctgggcgactggtacgtcgac
accgacgtgtggccgcagggcctccacccgctcgtcgagcgcgtgcgggagcgcgggatg
cagttcgggctgtggttcgagcccgagatggtcaaccccgactcggacctcgcccgcgcg
caccccgagtggatcctcggccccggcccgagcctgccgcccgaggcgcgtcaccagcag
gtgctcgacctggccgacccggacgccttcgcgtacgtgctcggccggctcgacgccgtc
atcagcgagtacgacgtcgacttcgtcaagtgggaccacaaccgcgacctcgtcgcgccc
gggcgcggcccacgccgcacggccgggacccacgagcagacgctcgccgtctaccgcctg
gtcgacacgctgcgcgagcgccacccacggctcgagatcgagtcgtgctcgtcgggcggc
gcgcgcgtcgacctcggcatcctccagcgcacggaccgcgtctgggccagcgactcgatc
gacgcgctcgagcgccagcacatcgaacgctggacgcgtctgctgctgccgcccgagctc
gtcggttcgcacatcgggtcggcgtgggcggccgcgaccggccgcacccacgagctcgag
atgcgggcgggcacggcgttcttcggcagcctcggcatcgagcgcgacctgcgtcacgcc
gacgccgaggagcgtgccgcgctccaggcctggatcgccctgtaccagcagcaccaggag
ctgctccacaccgggcgcttccacaccgtggaccacggcgacccgtcgctgcacgtccac
ggcgtcgtcgcgcaggaccaggccgaggcgatctactccttcgtcgcggtggcgacgtcc
gagtacgcgcggccgggcctggtgcggctgcccggcctcgacccggacgtcagctacgac
gtacggcccgtgccgctcgccgcgcgcgtcgagaagttcatggggttcaccgctcccccc
tggtgggctgacgggatcacccttcccggcagcgtcctgtcccggcacggggtgcagatc
cccgcgctctttcccgagaggttgacgatggtgcatgtgcagcgggcgacggcggtcgcg
cgatga

DBGET integrated database retrieval system