KEGG   Xylanimonas cellulosilytica: Xcel_2121Help
Entry
Xcel_2121         CDS       T01135                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_2121
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_2121
   00052 Galactose metabolism
    Xcel_2121
   00500 Starch and sucrose metabolism
    Xcel_2121
   00520 Amino sugar and nucleotide sugar metabolism
    Xcel_2121
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Xcel_2121
   00524 Butirosin and neomycin biosynthesis
    Xcel_2121
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Xcel_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2279895..2280815
Genome map
AA seq 306 aa AA seqDB search
MRVAIGVDVGGTKTAAGVVGPRGELLRTTVRPTPARAGAAAVLATACDVAATLLAWARGQ
GHDVVGCGAGVAGTVDLAGVITHATDALPGWAGTDVASALAAATGLPARVVNDVHALALG
EVRSGAAAGLPSALVVAVGTGIGGAFVVGGELVVGRTGTAGAIGHVPVVGESRPCPCGGV
DHLEAYASGPAIVARYRERGGAAARLEDVVAAAGAGVVLARDALAEAGAMIGYAVAGAMN
LLDPHAVVLGGGVVNVGPMLLDAVRREIAASALPGPRAVPVRTVAVPEYANVIGAASLVT
LETASA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgcgatcggtgtcgacgtcggcgggacgaagaccgcggccggggtggtcggc
ccgcgcggcgagctgctgcgcaccaccgtacggccgacgccggcccgcgcgggcgcggcc
gccgtcctggccaccgcctgcgacgtcgcggccaccctcctggcctgggcgcgcgggcag
gggcacgacgtcgtgggctgcggcgccggcgtcgcgggaacggtggacctcgcgggcgtc
atcacccacgcgaccgacgccctgcccggctgggccggcaccgacgtcgcctcggcgctg
gccgcagcgacaggcctgccggcccgggtcgtcaacgacgtccacgccctcgccctgggc
gaggtgcggtccggggcggccgccggcctgccgagcgcgctcgtcgtcgcggtcggcacg
gggatcggtggggccttcgtcgtgggcggagagctggtcgtcggccggaccggcacggcg
ggagcgatcgggcacgtacccgtcgtcggcgagtccaggccgtgcccctgtggcggcgtc
gaccatctggaggcgtacgcgtccgggccggcgatcgtggcgcggtaccgcgagcgcggc
ggtgcggcggcgcggctcgaggacgtcgtcgcggcggcgggcgccggcgtcgtcctggcc
cgcgacgcgctcgcggaggcgggcgcgatgatcgggtacgccgtcgccggagcgatgaac
ctcctggacccccacgccgtcgtgctcgggggcggcgtggtcaacgtcggcccgatgctg
ctcgacgccgtgcggcgcgagatcgctgcgagcgctctgcccggcccgcgcgccgtgccc
gtccgcaccgtcgcggtgccggagtacgcgaacgtgatcggcgctgcgagcctcgtcacg
ctggagacggcctccgcctga

DBGET integrated database retrieval system