KEGG   Xylanimonas cellulosilytica: Xcel_2263Help
Entry
Xcel_2263         CDS       T01135                                 

Definition
Protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xce  Xylanimonas cellulosilytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2444689..2445261
Genome map
AA seq 190 aa AA seqDB search
MEDDDVAAALRAVPRGGFLPRLQRPLAAQDRPLEIGHGQTCSQPSTVAAMLRLLRVPRGA
RVLDVGAGSGWTTALLAHLVGPDGEVFGVERRADLAAWGAANVARAGMPWAREVRAEEGV
LGRPRADGWDRILVSAAADDLPAALVGQVATGGRMVIPVRHAMVLVEVDDDGAVRTSEHG
TYAFVPLIED
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgacgacgtcgccgcggcgctgcgggcggtaccccgtggcgggttcctccct
cgcctgcagcgccccctggcggcccaggaccgcccgctcgagatcgggcacggacagacc
tgctcgcagccgtcgacggtcgcggcgatgctgcgcctgctccgggtaccgcgcggcgca
cgcgtgctcgacgtcggcgcgggctccggctggacgacggcgctgctggcgcacctggtg
gggccggacggggaggtgttcggcgtcgagcgccgcgcggacctggccgcctggggcgcg
gcgaacgttgcccgggccggcatgccgtgggcgcgtgaggtgcgggcggaggagggcgtg
ctcggccgtccgcgtgcggacggctgggaccggatcctcgtgtcggcggccgccgacgat
ctgcccgcggcgctggtcggccaggtcgcgacgggcgggcgcatggtgatcccggtccgc
cacgcgatggtgctcgtggaggtcgacgacgacggcgcggtccgcacctcggagcacggc
acgtacgcgttcgtccccctgatcgaggactag

DBGET integrated database retrieval system