KEGG   Xylanimonas cellulosilytica: Xcel_2405Help
Entry
Xcel_2405         CDS       T01135                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Xcel_2405
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_2405
   00620 Pyruvate metabolism
    Xcel_2405
   00650 Butanoate metabolism
    Xcel_2405
  Lipid metabolism
   00071 Fatty acid degradation
    Xcel_2405
  Amino acid metabolism
   00350 Tyrosine metabolism
    Xcel_2405
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xcel_2405
   00626 Naphthalene degradation
    Xcel_2405
Enzymes [BR:xce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Xcel_2405
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Xcel_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2618024..2620759)
Genome map
AA seq 911 aa AA seqDB search
MSPTKKAKPAEVVTTDAAATPVHDAATEVNDLVQRGLKALAAYASFTQEQIDHIVKKASV
AALHEHGNLAKLAVEETGRGIFEDKATKNIFACEHVTHSMAKMKTVGVIGRDDLRGIVEI
AEPVGVIAGVTPVTNPTSTAIFKALMAIKTRNPIIFGFHPSAQQCSIAAAKIVRDAAIEA
GAPEDCVQWIEHPSIQATSELMNHPGVSLVLATGGNAMVRAAYSTGKPALGVGAGNVPAY
VAKDAKLGRAINDIVLSKGFDNGVVCASEQAAILDTEIYDEALEEFRRLHAYVVTPEEKT
KLEEYFFGVTANSVNCAGAKLNAAVVGKSAVWLAEQAGFTVPADTSILLAEISGVGPHEP
LSREKLSPLLAVLRANSTEEGIRLSEQMVEFDGLGHSGAIHTEDKALSEEFGRRVKAVRI
LWNQPSALGGIGDIYNALIPSLTLGCGSYGANSVSNNVSAVNLINVKRVARRNNNMQWFK
VPPKTYFEPNSIQYLADMRDVERVTIVTDRVMASPEIGIVDKVLDVLHRRDNPVAVQIID
TVEPEPSVETVEKGAQLMRDHRPDTIIAIGGGSPMDASKVMWLKYEHPELDFADLREKFF
DVRKRAFQYPTLGKLAQLVCIPTSSGTGAEVTPFAVISDHKTGYKYPLADYALTPSVAII
DPVLTASMPAKLAVDSGMDALTHATEAFVSVYANDFTDGLALHAIKLVFENIEKSALTGD
TEAREKMHNAATIAGMAFGNAFLGIVHAMSHTVGATHKLIHGRTNAMFLPYAIRYNGLVP
GKVTGWPKAEKYIAPERFQVIAKHLGLPASTPQEAVESYANACRDLATRIGVEASFQAQG
VSEQEYIGGLDALAMRAYEDQCAPANPRLPMLQDMKDIMVAAYYGITQDEVRAQRLDGVA
YLDMNPARVTA
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
gtgagccccaccaagaaggcgaagccggccgaggtcgtcacgaccgacgccgccgccacc
cccgtgcacgacgccgccaccgaggtcaacgacctcgtgcagcgcggcctcaaggccctg
gccgcctatgcctcgttcacccaggagcagatcgaccacatcgtcaagaaggcgtcggtc
gccgccctgcacgagcacggcaacctcgccaagctcgccgtggaggagaccggccgcggc
atcttcgaggacaaggccaccaagaacatcttcgcgtgcgagcacgtcacgcactcgatg
gccaagatgaagaccgtcggcgtcatcggccgcgacgacctgcgcggcatcgtcgagatc
gccgagcccgtcggcgtcatcgccggtgtcaccccggtgaccaacccgacgtcgaccgcg
atcttcaaggccctcatggccatcaagacgcgcaacccgatcatcttcggcttccacccc
agcgcccagcagtgctcgatcgccgccgccaagatcgtgcgcgacgccgccatcgaggcc
ggtgcccccgaggactgcgtccagtggatcgagcacccctcgatccaggcgacgtccgag
ctgatgaaccacccgggcgtctcgctcgtgctggccaccggcggcaacgcgatggtccgc
gccgcctactcgaccggcaagcccgccctcggcgtcggcgccggcaacgtcccggcctac
gtcgccaaggacgccaagctcggccgcgcgatcaacgacatcgtcctgtccaagggcttc
gacaacggcgtggtctgcgcctctgagcaggccgccatcctcgacaccgagatctacgac
gaggcgctcgaggagttccgccgcctgcacgcctacgtcgtgacccccgaggagaagacg
aagctcgaggagtacttcttcggcgtcaccgccaactcggtgaactgcgccggggccaag
ctcaacgccgccgtcgtcggcaagtccgccgtctggctggccgagcaggccggcttcacc
gtgcccgccgacacctcgatcctcctcgcggagatctccggcgtcggcccgcacgagccg
ctgagccgcgagaagctctcgccgctgctggccgtcctccgcgccaacagcaccgaggag
ggcatccgcctgtccgagcagatggtggagttcgacggcctcggccactcgggcgccatc
cacaccgaggacaaggcgctctcggaggagttcggccgccgcgtcaaggccgtccgcatc
ctgtggaaccagccgtccgccctcggcggcatcggcgacatctacaacgccctcatcccg
tcgctcacgctgggctgcggctcctacggcgccaactcggtgtcgaacaacgtgtcggcc
gtcaacctgatcaacgtcaagcgcgtggcgaggcggaacaacaacatgcagtggttcaag
gtcccgccgaagacgtacttcgagccgaactcgatccagtacctggccgacatgcgtgac
gtcgagcgcgtcaccatcgtcacggaccgcgtgatggcgtcgcccgagatcggcatcgtc
gacaaggtcctcgacgtcctgcaccgccgcgacaacccggtcgccgtgcagatcatcgac
accgtcgagccggagccgagcgtcgagaccgtcgagaagggcgcgcagctcatgcgcgac
caccgccccgacacgatcatcgccatcggcggtggctcgccgatggacgcctcgaaggtc
atgtggctcaagtacgagcaccccgagctcgacttcgccgacctgcgcgagaagttcttc
gacgtccgcaagcgcgccttccagtacccgacgctcggcaagctcgcccagctcgtgtgc
atccccacgtcgtcgggcaccggcgccgaggtcacgccgttcgcggtcatctccgaccac
aagaccggctacaagtacccgctggccgactacgcgctgaccccgtcggtcgcgatcatc
gacccggtgctgaccgcgtcgatgccggccaagctcgccgtcgactcgggcatggacgcc
ctgacgcacgccaccgaggcgttcgtctccgtctacgccaacgacttcaccgacgggctg
gcgctgcacgccatcaagctggtcttcgagaacatcgagaagtcggcactgaccggcgac
accgaggcccgcgagaagatgcacaacgccgcgacgatcgccggcatggccttcggcaac
gcgttcctgggcatcgtgcacgccatgtcgcacaccgtcggcgcgacgcacaagctcatc
cacggccgcaccaacgccatgttcctgccctacgcgatccgctacaacggtctcgtcccg
ggcaaggtcaccggctggccgaaggcggagaagtacatcgctcccgagcgcttccaggtc
atcgccaagcacctgggcctgccggcctcgacgccgcaggaggcggtggagtcgtacgcc
aacgcgtgccgcgacctcgccacccgcatcggtgtcgaggcgtcgttccaggcgcagggc
gtgtccgagcaggagtacatcggcgggctcgacgccctggcgatgcgcgcctacgaggac
cagtgcgccccggcgaacccgcgtctgccgatgctgcaggacatgaaggacatcatggtc
gcggcgtactacggcatcacgcaggacgaggtgcgtgcccagcgtctcgacggtgtcgcc
tacctggacatgaacccggcccgcgtcacggcctga

DBGET integrated database retrieval system