KEGG   Xylanimonas cellulosilytica: Xcel_2464Help
Entry
Xcel_2464         CDS       T01135                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00260  Glycine, serine and threonine metabolism
xce00750  Vitamin B6 metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01230  Biosynthesis of amino acids
Module
xce_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xcel_2464
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Xcel_2464
Enzymes [BR:xce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Xcel_2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACZ31479
JGI: Xcel_2464
UniProt: D1BWD4
Position
complement(2687831..2688901)
Genome map
AA seq 356 aa AA seqDB search
MAHQWQGVIREYADRLPAHVQQTIVTLGEGGTPLVAAPALSARTGADVWVKVEGMNPTGS
FKDRGMTTAISAAAGRGAKAVVCASTGNTSASAAAYATRAGMTCAVLVPDGKIAMGKLSQ
AIAHGALLLQVDGNFDDCLVAARKLAEAYPVELVNSVNPDRIEGQKTAAFEIVDALGDAP
DIHALPVGNAGNITAYRKGFVEYAESGAASKAPAMWGFQAAGAAPLVKGFPIDEPETIAT
AIRIGKPASWDQAIAARDESGGVIEAVTDEQILAAHRILSAEVGVFVEPASAAGVAGILA
RAEAGLVPAGSRIVVTVTGHGLKDPSWALRTPDGGDVVPTRVSADVVSIADVLGLE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggcacatcagtggcagggcgtcatccgcgagtacgccgaccggctgcccgcccacgtg
cagcagacgatcgtcacgctgggggagggcggcacgccgctcgtcgccgcgccggcgctg
tcggcccgcacgggcgccgacgtctgggtcaaggtcgagggcatgaacccgaccgggtcc
ttcaaggaccgcggcatgacgacggcgatctcggccgcggccggtcgcggcgcgaaggcc
gtggtgtgcgcgtcgaccgggaacacctcggcgtcggccgccgcgtacgccacgcgcgcc
gggatgacctgcgcggtgctggtcccggacggcaagatcgccatgggcaagctgtcccag
gccatcgcccacggcgccctgctgctgcaggtggacggcaacttcgacgactgcctcgtg
gccgcccgcaagctggccgaggcctacccggtcgagctcgtcaactccgtcaaccccgac
cgcatcgaggggcagaagacggccgcgttcgagatcgtcgacgccctcggcgacgccccc
gacatccatgccctgccggtcggcaacgcgggcaacatcaccgcgtaccgcaagggcttc
gtggagtacgccgagtcgggtgcggcgagcaaggcgccggccatgtggggcttccaggcc
gccggtgccgcgccgctcgtcaagggcttcccgatcgacgagccggagaccatcgccacc
gccatccgcatcggcaagccggcctcctgggaccaggcgatcgctgcccgcgacgagtcc
ggcggcgtcatcgaggccgtcacggacgagcagatcctcgccgcccaccgcatcctgtcg
gccgaggtcggcgtgttcgtcgagccggcgtccgccgccggcgtcgccggcatcctcgcc
cgtgccgaggcgggtctggtgcccgcggggtcgcgcatcgtcgtcaccgtcacggggcac
ggtctcaaggacccgtcctgggcgctgcgcacgcccgacggcggcgacgtcgtcccgacc
cgcgtgagcgccgacgtcgtgagcatcgccgacgtcctgggcctggagtag

DBGET integrated database retrieval system