KEGG   Xylanimonas cellulosilytica: Xcel_2707Help
Entry
Xcel_2707         CDS       T01135                                 

Definition
Dolichyl-phosphate beta-D-mannosyltransferase (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3000124..3001278)
Genome map
AA seq 384 aa AA seqDB search
MSVTVVVPTYNEGPNVAELVRRLAATLPDGSDVLFVDDSRDDTPQIISDVAARAPLPVRL
IHRPEAVGGLSGAVVEGLRAAEAAGTDWVVVMDGDLQHPPELVPALVERGRASDADVVVA
SRYTGAGDAGGLDGRRRKLVSKVSGLLARSMFPVRLRNVTDPMTGFFALRTGRVDLDALR
PRGFKILLEVLARTRLAVVEEPFVFGERYAGESKASFANGVRYVQQLWGLRFGRLSPFAV
IGALGAVLNLLILWALQSAGVHYLPAVIASNGLTIVTNFLLQERFVFRDLRDGGSMGRRF
VQSFAFNGTEAVIRTLLLWWIVEAAFPHPELVQAGLILVAFLVRFVFHAQVVYKPRRTAP
ALDEMPSLDTLRPVRPVRPEAEER
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtgaccgtggtggtccccacgtacaacgagggaccgaacgtcgccgagctggtc
cgccggctcgccgcgacgctgcccgacggctccgacgtgctgttcgtcgacgactcccgc
gacgacaccccgcagatcatcagcgacgtcgcggcccgtgcgcccctgcccgtacgtctc
atccatcgccccgaggcggtcggcgggctgtccggcgccgtcgtcgaagggctgcgggct
gccgaggctgccgggaccgactgggtcgtggtcatggacggcgacctgcagcacccgccc
gagctcgtgcccgccctcgtcgagcgcgggcgggccagtgacgccgacgtcgtcgtcgcc
tcccggtacaccggcgcgggggacgcgggcgggctcgacggacgacgccgcaagctggtc
tccaaggtgtccgggctgctggcccggtcgatgttcccggtgcggctgcgcaacgtcacc
gacccgatgacagggttcttcgccctgcggaccggccgcgtggacctcgacgcgctgcgg
ccccgcgggttcaagatcctgctcgaggtgctggcccgcacccggctcgccgtcgtcgag
gagccgttcgtcttcggggagcggtacgcgggcgagtccaaggcgtcgttcgccaacggg
gtgcggtacgtgcagcagctctgggggctgcggttcggccggctgtcgccgttcgccgtc
atcggtgccctcggcgcggtgctcaacctcctgatcctgtgggccctgcagagcgcgggc
gtgcactacctgcccgccgtcatcgcctccaacggcctgacgatcgtcacgaacttcctg
ctccaggaacggttcgtgttccgcgacctgcgcgacggcgggtcgatggggcggcggttc
gtgcagtcgttcgccttcaacggcaccgaggccgtgatccgcacgctcctgctgtggtgg
atcgtcgaggcggccttcccgcaccccgagctggtccaggccgggctcatcctcgtcgcg
ttcctggtgcggttcgtgttccacgcgcaggtggtctacaagccgcggcgcaccgcgccg
gcgctcgacgagatgccgtcgctcgacacgctcaggccggtccggccggtcaggccggaa
gcagaggaacgctga

DBGET integrated database retrieval system