KEGG   Xylanimonas cellulosilytica: Xcel_2707Help
Entry
Xcel_2707         CDS       T01135                                 

Definition
Dolichyl-phosphate beta-D-mannosyltransferase (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Metabolic pathways
Brite
Enzymes [BR:xce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Xcel_2707
Glycosyltransferases [BR:xce01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Xcel_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3000124..3001278)
Genome map
AA seq 384 aa AA seqDB search
MSVTVVVPTYNEGPNVAELVRRLAATLPDGSDVLFVDDSRDDTPQIISDVAARAPLPVRL
IHRPEAVGGLSGAVVEGLRAAEAAGTDWVVVMDGDLQHPPELVPALVERGRASDADVVVA
SRYTGAGDAGGLDGRRRKLVSKVSGLLARSMFPVRLRNVTDPMTGFFALRTGRVDLDALR
PRGFKILLEVLARTRLAVVEEPFVFGERYAGESKASFANGVRYVQQLWGLRFGRLSPFAV
IGALGAVLNLLILWALQSAGVHYLPAVIASNGLTIVTNFLLQERFVFRDLRDGGSMGRRF
VQSFAFNGTEAVIRTLLLWWIVEAAFPHPELVQAGLILVAFLVRFVFHAQVVYKPRRTAP
ALDEMPSLDTLRPVRPVRPEAEER
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtgaccgtggtggtccccacgtacaacgagggaccgaacgtcgccgagctggtc
cgccggctcgccgcgacgctgcccgacggctccgacgtgctgttcgtcgacgactcccgc
gacgacaccccgcagatcatcagcgacgtcgcggcccgtgcgcccctgcccgtacgtctc
atccatcgccccgaggcggtcggcgggctgtccggcgccgtcgtcgaagggctgcgggct
gccgaggctgccgggaccgactgggtcgtggtcatggacggcgacctgcagcacccgccc
gagctcgtgcccgccctcgtcgagcgcgggcgggccagtgacgccgacgtcgtcgtcgcc
tcccggtacaccggcgcgggggacgcgggcgggctcgacggacgacgccgcaagctggtc
tccaaggtgtccgggctgctggcccggtcgatgttcccggtgcggctgcgcaacgtcacc
gacccgatgacagggttcttcgccctgcggaccggccgcgtggacctcgacgcgctgcgg
ccccgcgggttcaagatcctgctcgaggtgctggcccgcacccggctcgccgtcgtcgag
gagccgttcgtcttcggggagcggtacgcgggcgagtccaaggcgtcgttcgccaacggg
gtgcggtacgtgcagcagctctgggggctgcggttcggccggctgtcgccgttcgccgtc
atcggtgccctcggcgcggtgctcaacctcctgatcctgtgggccctgcagagcgcgggc
gtgcactacctgcccgccgtcatcgcctccaacggcctgacgatcgtcacgaacttcctg
ctccaggaacggttcgtgttccgcgacctgcgcgacggcgggtcgatggggcggcggttc
gtgcagtcgttcgccttcaacggcaccgaggccgtgatccgcacgctcctgctgtggtgg
atcgtcgaggcggccttcccgcaccccgagctggtccaggccgggctcatcctcgtcgcg
ttcctggtgcggttcgtgttccacgcgcaggtggtctacaagccgcggcgcaccgcgccg
gcgctcgacgagatgccgtcgctcgacacgctcaggccggtccggccggtcaggccggaa
gcagaggaacgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system