KEGG   Xylanimonas cellulosilytica: Xcel_2724Help
Entry
Xcel_2724         CDS       T01135                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Xcel_2724
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Xcel_2724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3022149..3023105)
Genome map
AA seq 318 aa AA seqDB search
MNRPGTRSSRLAAAPPPSVRVRAPGKVNLSLRVGPLDDDGYHPLVSVFQAVALFEEVTAT
QVVAGAGISLTVDGPQADAVPRDRTNLAWKAAELLAMHTGVDPDVALHVRKGVPVAGGMA
GGSADAAAALVACDALWETGVPRTELVELAAALGSDVPFCLLGHTAVGTGRGQLLTPAMT
RGEFHWVFAASHTGLSTPQVFAAFDELTRGGAAAVGVEDDTALMQALRAGDPTALGAALH
NDLQDAALSLRPELARTLEIAREAHALGAIVSGSGPTVAALARSRQHALAIAATWTAEGA
ADSVWTTTAPAHGARVVA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgacccgggacgcgctcctcccgcctcgccgccgcaccaccgccgtcggtgcgg
gtccgcgcccccggcaaggtcaacctctcgctgcgggtcggtccgctcgacgacgacggc
taccacccgctggtgagcgtgttccaggcggtggcgctgttcgaggaggtcacggccacc
caggtggtcgccggagccggcatctcgctgaccgtggacgggccgcaggccgacgccgtc
ccccgtgaccggacgaacctcgcgtggaaggctgccgagctgctcgccatgcacacgggc
gtggaccctgacgtggcgctgcacgtacgcaagggtgtgccggtcgcggggggaatggcg
ggcgggtccgcggacgccgctgccgccctggtggcgtgcgacgccctctgggagacgggt
gtgccgcgcaccgagctcgtcgagctggccgccgcgctcggttcggacgtgccgttctgc
ctgctcgggcacaccgccgtcggcacgggacgcggccagctcctgaccccggcgatgacg
cgtggcgagttccactgggtgttcgcggcgtcccataccgggctctcgacgccgcaggtc
ttcgccgccttcgacgagctgacgcgcggcggagcggcggcggtgggcgtcgaggacgac
accgcgctgatgcaggcgctgcgtgcgggcgacccgaccgcgctcggcgccgcgctgcac
aacgacctccaggacgcggcgctgtccctgcgccccgagctggcccggacgctggagatc
gcccgtgaagcgcacgcgctgggcgcgatcgtctcgggcagcggacccacggtggccgcc
ctggcccgctcccgccagcacgccctggcgatcgcggcgacctggacggcggagggcgcc
gccgactcggtctggacgacgacggccccggcccacggcgcccgcgtcgtcgcctga

DBGET integrated database retrieval system