KEGG   Xylanimonas cellulosilytica: Xcel_2827Help
Entry
Xcel_2827         CDS       T01135                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Xcel_2827
   00051 Fructose and mannose metabolism
    Xcel_2827
Enzymes [BR:xce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Xcel_2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3142044..3143198
Genome map
AA seq 384 aa AA seqDB search
MSDIKYAFGLWTTGWQGVDPFGDATRPALDPAENIRKLAELGAHAFTFHDNDVWPIDATD
AERAAAIESVKKASAETGLVCEMVTTNTFSHPVFKAGAFTSNDRNIRRYGLRKVLKQVDL
GAELGASTFVMWGGREGVEYANSKDLGTAHARYAEGIDTVAAYIKSKGYDMRVALEPKPN
EPRGDIFLPTIGHAIALINSLDNGDIVGVNPETGHEQMAGLNYTHGLALALYVGKLFHID
LNGQNGPKYDQDLVFGHGNLLDAFFTVDLLENGSPNGEIAPYVGYRHFDYKPSRTEYTDG
IWESAAANMKTYSLLAEASKAYRADAEVQAAFEKAGVLDKSATLAEGESFESFLAEPDED
ITELGKRHEGLVHLHQLALNHILG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacatcaagtacgcgttcggcctctggaccaccggctggcagggcgtcgacccg
ttcggcgacgcgacccgcccggctctcgacccggccgagaacatccgcaagctcgccgag
ctcggcgcgcacgcgttcaccttccacgacaacgacgtgtggcccatcgacgccaccgac
gccgagcgcgccgccgcgatcgagtcggtcaagaaggcctccgccgagaccggcctggtc
tgcgagatggtcaccaccaacacgttctcgcacccggtgttcaaggccggcgcgttcacc
tcgaacgaccgcaacatccgccgctacggcctgcgcaaggtcctcaagcaggtcgacctc
ggtgccgagctgggcgccagcacgttcgtcatgtggggcggccgcgagggcgtcgagtac
gcgaactcgaaggacctgggcaccgcccacgcccgttacgccgagggcatcgacaccgtc
gccgcctacatcaagtcgaagggctacgacatgcgcgtcgccctcgagccgaagccgaac
gagccccgcggcgacatcttcctgccgacgatcggtcacgccatcgcgctgatcaactcg
ctcgacaacggcgacatcgtcggcgtgaacccggagacgggccacgagcagatggccggc
ctgaactacacccacggcctcgccctcgccctgtacgtcggcaagctgttccacatcgac
ctcaacggtcagaacggcccgaagtacgaccaggacctcgtcttcggtcacggcaacctg
ctcgacgccttcttcaccgtcgacctgctcgagaacggctcgccgaacggcgagatcgct
ccttacgtcggctaccgccacttcgactacaagccctcgcgtaccgagtacacggacggc
atctgggagtcggctgccgccaacatgaagacctactcgctgctcgccgaggcctcgaag
gcgtaccgcgccgacgccgaggtccaggccgcgttcgagaaggccggcgtgctcgacaag
tcggcgaccctcgccgagggcgagtcgttcgagtcgttcctcgcggagcccgacgaggac
atcaccgagctcggcaagcgtcacgagggcctggtgcacctgcaccagctcgcgctgaac
cacatcctcggctga

DBGET integrated database retrieval system