KEGG   Xylanimonas cellulosilytica: Xcel_2915Help
Entry
Xcel_2915         CDS       T01135                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xce00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xce00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:xce00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3237735..3239855)
Genome map
AA seq 706 aa AA seqDB search
MPVRTTASPPLITWGDGPTRLVLRHGPDTPVMAQVWRSDSEHPVDAQPLVEVIAVGHGHA
SANLRNTATAIGARLRFVNHRVETVQGLTTVLVTQVDEVTGLEAVTALRGRAGGSAVQAT
TTLRNTGDSSVHLQAVSSLMLADPTGVPAIDSVSSLEGTNEWLGEWRWAAQALRGGDDAA
GLPVLGLASHQRQDARSARVVVSHGTWSSGERAPVGVVSGPSGSLAWQVEHPGPWRMELG
VRLDADDVDRLVLGILGATDADHSWVRTLAPGEEFASIPVSVAWSSGDWQETIAELTRHR
RAIRTPERAATVVVFNDYMNTLMGDPTTAKLLPLIGAAGKAGADYFCIDAGWYADEGDWW
DAIGEWEPSAKRFPDGGLAVPIGAIRAAGMIPGLWLEPEVVGVRSPMAHRLPDEAFLQRH
GMRVVEHDRYLLDMRHPAAREHLDATVDRLVEEFGLGFFKLDYNVTPGLGTDLNADSPGD
GLLEHTRAYLRWLDGVLERHPHLVIENCASGAQRADYGLLSRLEMQSTTDQQEALRYPAI
AAGALVAMLPEQAGNWAYPQPSMTDEEIAFTMVTGLSGRIYLSGHLDQMSDEQLALVREG
VAVAKTLDDGALATSPVWPAGLPGTGSPWVLAGRATADETLLAVWFLGGQQREISVPMRG
GALQTVYPTSLAPAFDARLADGRLHLTALGEEPVARLIRIHHDDAA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtacgaacgacggcgagcccgccgctgatcacctggggcgatgggcccacgcga
cttgtcctccgccacggaccggacaccccggtgatggcgcaggtgtggcgcagcgactcc
gagcatcctgtcgatgctcagccgctggttgaggtcatcgccgtcgggcatgggcacgcg
tcggcgaacctccgcaacacggcgaccgcgatcggtgcccgcctgcgcttcgtgaaccat
cgcgtcgagaccgtgcagggactgaccaccgtgctcgtcacgcaggtcgacgaggtcacg
ggcctggaggccgtgaccgcgctgcgtggccgggcgggaggatcggcggttcaggcgacg
acgacactgcgcaacaccggagactcctcggtccacctgcaggcggtctcttcgctcatg
ctggcggatccgacaggcgttcccgccatcgactcggtgagcagcctcgaggggaccaac
gagtggctcggtgaatggcgttgggctgcccaggcgctgcgtggcggagacgacgcggcc
gggctgccggtgcttggtctcgccagccaccagcgtcaggacgcgcgcagcgctcgcgtc
gtcgtgtcgcacgggacctggtcgtcgggtgagcgggctccggtgggcgtggtctcgggt
ccgtcgggaagcctggcctggcaggtcgagcatcctgggccgtggcggatggagctgggc
gtccggctcgatgccgacgacgtcgatcgtctggtcctgggcatcctcggtgccacggac
gccgatcactcctgggtccgcacgctggcgccgggggaggagttcgcgtcgatcccggtc
tccgtggcctggtcgagcggggactggcaggagacgatcgctgagctcacgcgtcaccgc
cgggcgatccgcactcccgagcgggcggcaaccgtcgtcgtcttcaacgactacatgaac
accctcatgggcgaccccaccaccgccaagcttctgccgctgatcggtgccgcgggcaag
gcgggcgccgactacttctgcatcgacgccggctggtatgcggacgagggcgactggtgg
gacgcgatcggtgagtgggagccgtccgccaagcggttccccgacgggggcctcgcggtt
cccatcggcgcgatccgtgcggcgggcatgatccccggcctgtggctggaaccggaagtt
gtcggtgtgcgaagcccgatggcgcaccggctcccggacgaggcgttcctgcagcgtcac
gggatgcgcgtcgtcgagcacgaccggtacctcctcgacatgcggcaccctgccgcacgg
gagcaccttgacgccacggtcgaccggctcgtcgaggagttcgggctcgggttcttcaag
ctcgactacaacgtcactcccggcctcggcaccgatctgaacgcagacagcccgggagac
gggctcctcgagcacacgcgcgcgtacctgcggtggctcgacggcgtgctcgaacgccac
ccgcacctcgtgatcgagaactgcgcatcgggggcgcagcgagccgactatggcttgctg
tcgcgcctggagatgcagtccaccaccgaccagcaagaggcactccgctacccggcgatc
gccgctggagcactcgtcgcgatgctgcctgagcaggctgggaactgggcctacccccag
ccgtcgatgacggatgaagagatcgcgttcacgatggtcacaggtctctcggggaggatc
tacctgtccgggcatctcgaccagatgagcgacgagcagcttgcgctggttcgcgagggc
gtcgcagtcgccaagacgctcgacgatggcgccctggccacgagcccggtgtggcctgcc
ggcctgcccggcacgggatcgccatgggttctcgcgggccgtgccaccgcagacgagacg
ctgctggccgtctggttcctcggtggccagcagcgtgagatctctgtgcccatgcgcggc
ggagcgctccagaccgtctacccgacgtcgctcgctccggcgttcgacgcccggctcgcc
gacggccgacttcacttgactgcactcggcgaggagccggtcgcacgcctcatccgcatc
caccacgacgacgcggcgtag

DBGET integrated database retrieval system