KEGG   Xylanimonas cellulosilytica: Xcel_2972Help
Entry
Xcel_2972         CDS       T01135                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_2972
   01230 Biosynthesis of amino acids
    Xcel_2972
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_2972
  Energy metabolism
   00680 Methane metabolism
    Xcel_2972
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xcel_2972
Enzymes [BR:xce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Xcel_2972
Exosome [BR:xce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Xcel_2972
  Exosomal proteins of melanoma cells
   Xcel_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3301599..3302342)
Genome map
AA seq 247 aa AA seqDB search
MGMTYTLVLLRHGESEWNAKNLFTGWVDVPLSEKGRGEATRGGELLKEAGVNPDVVHTSL
LRRAIMTANLALDSADRHWIPVKRSWRLNERHYGDLQGKDKKQVRDQYGDDQFMLWRRSY
DVPPPEIELGSEFSQDADVRYAGEPIPRAEALAQVLVRALPYWESEIVPDLKAGKTVLVA
AHGNSLRAIVKHLDGIDDATIAGLNIPTGIPLVYELDEDFTPVTPGGTYLDPAAAADAIA
AVANQGK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgacctacaccctcgtgctgctccgccatggcgagagcgagtggaacgccaag
aacctcttcaccggctgggtcgacgtgcccctgtccgagaagggccgcggggaggccacc
cgtggtggcgagctcctcaaggaggcgggcgtcaaccccgacgtcgtccacacgtcgctc
ctgcgccgcgccatcatgaccgccaacctggccctcgactccgccgaccggcactggatc
ccggtcaagcggtcgtggcgcctcaacgagcgtcactacggtgacctccagggcaaggac
aagaagcaggtccgcgaccagtacggcgacgaccagttcatgctgtggcgccgttcctac
gacgtgccgccgcccgagatcgagctcggctcggagttctcgcaggacgccgacgtgcgc
tacgccggggagccgatcccgcgcgccgaggcgctcgcgcaggtgctcgtccgggccctg
ccgtactgggagtccgagatcgtccccgacctcaaggcgggcaagacggtgctggtggcc
gcgcacggcaactcgctgcgcgccatcgtcaagcacctcgacggcatcgacgacgcgacc
atcgcgggcctcaacatccccacgggcatcccgctggtctacgagctggacgaggacttc
acgccggtcacgcccggcggcacctacctcgaccccgccgccgcggccgacgcgatcgcc
gcggtcgccaaccagggcaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system