KEGG   Xylanimonas cellulosilytica: Xcel_2972Help
Entry
Xcel_2972         CDS       T01135                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_2972
   01230 Biosynthesis of amino acids
    Xcel_2972
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_2972
  Energy metabolism
   00680 Methane metabolism
    Xcel_2972
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xcel_2972
Enzymes [BR:xce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Xcel_2972
Exosome [BR:xce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Xcel_2972
  Exosomal proteins of melanoma cells
   Xcel_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3301599..3302342)
Genome map
AA seq 247 aa AA seqDB search
MGMTYTLVLLRHGESEWNAKNLFTGWVDVPLSEKGRGEATRGGELLKEAGVNPDVVHTSL
LRRAIMTANLALDSADRHWIPVKRSWRLNERHYGDLQGKDKKQVRDQYGDDQFMLWRRSY
DVPPPEIELGSEFSQDADVRYAGEPIPRAEALAQVLVRALPYWESEIVPDLKAGKTVLVA
AHGNSLRAIVKHLDGIDDATIAGLNIPTGIPLVYELDEDFTPVTPGGTYLDPAAAADAIA
AVANQGK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgacctacaccctcgtgctgctccgccatggcgagagcgagtggaacgccaag
aacctcttcaccggctgggtcgacgtgcccctgtccgagaagggccgcggggaggccacc
cgtggtggcgagctcctcaaggaggcgggcgtcaaccccgacgtcgtccacacgtcgctc
ctgcgccgcgccatcatgaccgccaacctggccctcgactccgccgaccggcactggatc
ccggtcaagcggtcgtggcgcctcaacgagcgtcactacggtgacctccagggcaaggac
aagaagcaggtccgcgaccagtacggcgacgaccagttcatgctgtggcgccgttcctac
gacgtgccgccgcccgagatcgagctcggctcggagttctcgcaggacgccgacgtgcgc
tacgccggggagccgatcccgcgcgccgaggcgctcgcgcaggtgctcgtccgggccctg
ccgtactgggagtccgagatcgtccccgacctcaaggcgggcaagacggtgctggtggcc
gcgcacggcaactcgctgcgcgccatcgtcaagcacctcgacggcatcgacgacgcgacc
atcgcgggcctcaacatccccacgggcatcccgctggtctacgagctggacgaggacttc
acgccggtcacgcccggcggcacctacctcgaccccgccgccgcggccgacgcgatcgcc
gcggtcgccaaccagggcaagtag

DBGET integrated database retrieval system