KEGG   Xylanimonas cellulosilytica: Xcel_2985Help
Entry
Xcel_2985         CDS       T01135                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xce00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3314291..3315238)
Genome map
AA seq 315 aa AA seqDB search
MPAPTWSRDVPVAGVPELSGVGRCLVMGVVNVTPDSFSDGGEWFSPEAGVRHGLELLGEG
ADIVDVGGESTRPGSARVPEEQELARVMPVIERLAAAGAVVSVDTTRARVAERAVAAGAR
IVNDVSGGLADPEMGRAVAETGAAYVCMHWRGHADVMDSLEVYDDVVTDVRDELAAQMAA
LEADGVRREQIVLDPGLGFAKSGDLNWPLLAHLDALQALGRPVLVGASRKRFLGRLLASG
RRDGGIDVAEPAPPLARDDATAAISALAAAAGAWAVRVHAARASHDAVRVAAAWAAAGTR
RAPGGPDFDGEVPTP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcccccacctggtcccgcgacgtccccgtcgcgggcgtgcccgagctctccggc
gtcggccggtgcctggtgatgggcgtcgtcaacgtcacgcccgactcgttctccgacggc
ggcgagtggttctcgcccgaggccggggtgcgccacgggctcgagctgctcggggagggc
gccgacatcgtcgacgtcggcggggagtccacccgccccggctccgcgcgcgtgcccgag
gagcaggagctcgcccgcgtcatgcccgtgatcgagcggctcgccgccgccggcgccgtc
gtctcggtggacaccacccgggcccgcgtggccgaacgggccgtcgccgcgggcgcccgc
atcgtcaacgacgtctccggcggcctcgccgacccggagatgggccgcgccgtcgccgag
acgggcgccgcgtacgtgtgcatgcactggcgcgggcacgccgacgtcatggactccctc
gaggtgtacgacgacgtcgtcaccgacgtccgcgacgagctcgccgcccagatggccgcc
ctggaggccgacggcgtgcgccgcgagcagatcgtgctcgaccccgggctcgggttcgcc
aagtccggcgacctcaactggccgctgctggcccacctcgacgcgctccaggcgctcggg
cggccggtgctcgtcggggcgtcgcgcaagcggttcctcgggcggctcctggccagcggg
cgccgggacggcggcatcgacgtcgcggaacccgcgcccccgctcgcccgcgacgacgcg
accgccgcgatctcggcgctcgccgccgcggccggggcctgggcagtgcgcgtccacgcg
gcgcgtgcgagccacgatgcggtgcgggtcgcggcagcatgggccgctgcggggacccgt
agggcccctggcggcccggatttcgacggagaggtgccaacgccatga

DBGET integrated database retrieval system