KEGG   Xylanimonas cellulosilytica: Xcel_3146Help
Entry
Xcel_3146         CDS       T01135                                 

Definition
(GenBank) glycoside hydrolase family 6
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00500  Starch and sucrose metabolism
xce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Xcel_3146
Enzymes [BR:xce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Xcel_3146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2 CBM49 DUF4179 Trypan_PARP Lamp
Motif
Other DBs
NCBI-ProteinID: ACZ32147
JGI: Xcel_3146
UniProt: D1C0E4
Position
3484453..3485832
Genome map
AA seq 459 aa AA seqDB search
MTTRRHRLATLAAAVSLAAAGAVVTATSASAAPGCAVTYQVANAWQGGFQGDVTVENVGD
ALSSWTLEWTAAAGQGVDQAWNATVSQSGNQVTATNVAWNGSLATGASASFGFIGSGSST
PVPTSFTVNGVTCTGSVTTPTPTPTPTPTPTPTPTPTPTPDPTPTPTPTPTPTPTVPPVE
AGELYVDPTTQAYAAWEAASGADKALLEKIALTPQSYWVGNWADAAHSKAEVVDYTSRAV
AAGKTGILTVYAIPGRDCGNHSGGGVETSEYAAWIDTVASGIQGRPYVVLEPDALPQLGD
CDGQGDRVGYLKYAAEKLTAAGGRVYIDAGHSGWMGVGTAVERLNQIGFDHAVGFALNTS
NYQTTADSISYGEQISQQLGGRPYVIDTSRNGNGSNGEWCNPSGRALGEKPRVVNDSTGL
DALLWIKLPGESDGSCNGGPAAGQWFGAMALELARNAAW
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgactacccgacgccatcgtctcgcgaccctggccgccgccgtctcgctggccgcggcc
ggcgccgtcgtgaccgcgaccagcgccagcgcggctcccggctgcgccgtcacctatcag
gtcgccaacgcgtggcagggcggcttccagggcgacgtgaccgtggagaacgtgggcgat
gccctctcctcgtggaccctggagtggacggccgccgccgggcagggcgtggaccaggcg
tggaacgccaccgtgtcgcagtccggcaaccaggtgaccgcgacgaacgtcgcctggaac
gggtcgctcgccacgggggcgagcgcgtcgttcggcttcatcgggtcgggcagctcgacg
ccggtgccgacgtcgttcaccgtcaacggcgtgacgtgcacgggttcggtgacgacgccg
accccgacgcccactccgacacctactcccactccgacgccgacgccgacgccgacgccg
gaccccacgcctacccccacccccactcccactccgacgccgaccgtgccgccggtcgag
gccggcgagctctacgtcgacccgacgacgcaggcgtacgccgcgtgggaggcggcatcg
ggcgccgacaaggcgctgctggagaagatcgccctgacgccccagtcctactgggtgggc
aactgggcggacgccgcgcactcgaaggccgaggtcgtcgactacacctcccgggcggtc
gccgcgggcaagaccggcatcctcaccgtctacgccatccccggccgcgactgcggcaac
cactccggcggcggcgtcgagaccagcgagtacgccgcctggatcgacacggtggcgtcg
ggcatccagggccgcccgtacgtcgtcctcgagccggacgccctcccccagctcggtgac
tgcgacggccagggcgaccgcgtcggctacctgaagtacgcggccgagaagctgaccgcc
gcgggcggccgcgtgtacatcgacgccggtcactcggggtggatgggcgtgggcaccgcc
gtcgagcggctgaaccagatcgggttcgaccacgccgtcggcttcgcgctcaacacctcg
aactaccagacgacggccgacagcatcagctacggcgagcagatctcgcagcagctcggc
ggacgcccgtacgtgatcgacacctcgcgcaacggcaacggctccaacggtgagtggtgc
aacccgagcgggcgcgccctcggcgagaagccgcgggtcgtgaacgactccacgggcctc
gacgccctgctgtggatcaagctgcccggcgagtccgacggttcgtgcaacggcggcccg
gccgccggccagtggttcggtgcgatggccctcgagctggcacgcaacgcggcgtggtga

DBGET integrated database retrieval system