KEGG   Xylanimonas cellulosilytica: Xcel_3221Help
Entry
Xcel_3221         CDS       T01135                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:xce01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xce00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:xce00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:xce00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3570906..3572483)
Genome map
AA seq 525 aa AA seqDB search
MSTQRFPLPDVGEGLTEAEIVEWKVAVGDTVTVNQVIVEIETAKSLVELPSPWAGTVVAL
LAEEGDTVDVGTPIIEVSSTPVVEPVETTPPTPVADPADSTEPPSVVEPVETTPTAEGSG
SVLVGYGTADAVAGRRRRRGTQPPALTQPTTRPQPPAAPPALSGAQGSAARRGPDNGSVV
GGVSGAGSAGARRGPDTSSGAVRVAPDAGAVSVPAAGGNGDAAHGRVLAKPPVRKLAKEL
GVDLATVAPTGPGGIVTREDLVAHAEAAKPQTLATYADDDRPWLASGSVASDGRSTRVPV
KSVRKRTAEAMVASAFTAPHVTVFHTVDVSKTMKLVAALKADREFADVRVTPLLIAAKAV
LLAVNRHPEINASWDDAAQEIVYKHYVNLGIAAATPRGLVVPNIKGAHRLDLLHLAREIA
NLTATARAGRTTPADMSDGTFTITNVGVFGIDTGTPILNPGEAGILAFGAIRQTPWVHKG
KIKPRWVTNLSLSFDHRLVDGELGSRFLSDVARVLEDPARALTWV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgcagcgtttccccctgcccgacgtcggtgagggcctgaccgaggccgagatc
gtcgagtggaaggttgcggtcggcgacaccgtcaccgtcaaccaggtcatcgtcgagatc
gagaccgccaagtccctcgtcgaactgccctcgccatgggcgggaacggtggtcgcgctg
ctcgccgaggagggcgacacggtcgacgtcggaaccccgatcatcgaggtctcatcgacc
ccggtggttgagcctgtcgaaaccaccccgccaaccccggtggccgaccctgccgactcc
actgagccgccctcggtggttgagcctgtcgaaaccaccccgaccgccgaaggttccggc
tccgtccttgtcggctacggcaccgctgacgcggtcgcgggccgtcgccgtcgccgcggc
acccagcccccggccctcacccagcccaccacccgccctcagcctccggccgcacccccc
gcgctgtcaggagcacagggcagcgccgcacgccgtggccctgacaacggcagcgtcgtc
gggggcgtgtcaggcgctgggagcgccggagcacgccgtgggcctgacacgtcgtcgggg
gcggttcgcgtcgcgcccgacgccggggccgtctccgtgccggctgcgggcgggaacggc
gacgccgcgcacggacgcgtgctcgccaagccgccggtgcgcaagctcgccaaggagctc
ggcgtcgacctggcgaccgtggcccccaccggaccgggcggcatcgtcacgcgcgaggac
ctcgtggcgcacgcggaggctgcgaagccgcagacgctcgccacgtacgccgacgacgac
cggccctggctggcctccggctcggtcgcgtccgacggccgcagcacccgcgtgccggtg
aagtcggtgcgcaagcggaccgccgaggcgatggtcgcgagcgcgttcaccgcaccgcac
gtcacggtgttccacacggtcgacgtcagcaagaccatgaagctcgtcgccgcgctgaag
gccgatcgtgagttcgcggacgtgcgcgtcacgccgctcctgatcgccgccaaggcggtg
ctgctcgccgtcaaccgccacccggagatcaacgcgagctgggacgacgccgcgcaggag
atcgtctacaagcattacgtgaacctggggatcgccgccgcgaccccgcgaggcctggtg
gtcccgaacatcaagggcgcccaccgcctcgacctgctccacctcgcccgggagatcgcc
aacctgacggcgaccgcgcgtgccggccgcaccacccccgcggacatgtccgacggtacg
ttcacgatcaccaatgtgggcgtcttcggcatcgataccggcacgccgatcctcaacccg
ggcgaggcgggaatcctcgccttcggcgccatccggcagacgccgtgggtgcacaagggc
aagatcaagccgcgctgggtcacgaacctgtcgctgagcttcgaccaccgcctggtggac
ggcgagctgggctcccgcttcctgtcggacgtggcccgagtcctggaggacccggcccga
gccctcacctgggtctga

DBGET integrated database retrieval system