KEGG   Xylanimonas cellulosilytica: Xcel_3250Help
Entry
Xcel_3250         CDS       T01135                                 

Definition
FAD dependent oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Xcel_3250
Enzymes [BR:xce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Xcel_3250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3605502..3607001
Genome map
AA seq 499 aa AA seqDB search
MSGGGGVVSTGSTTGGGSADAPPEKVDAVVVGGGIGGLTAARTLARRGLRVVVLEADAVP
GGPVRGGHFASLPSVPIDVGVESYAARGLAVTELAAELGLTGAVPAAAQAWGYSAGRTFP
LPKAGMLGIPSTPWAADVRRAIGWPGVLRASLDRVLPARFVDTSSLGALVRSRMGRRVAD
RLVTLIAAGVHSATVDSLDVSAVAPGLLDAFAREGSLSRAVGSLRKAAPAGAMVRGVDGG
IHAIIEAMVGELNADAEHWAPDDALATGAGVRCGEKVVGIERVAGLGGSAAAGRWQVTTA
TGTVVVAPKLVVATPAVAPLLAPVVGVDPPTATPGAPIALVALLLDAPELDAAPRGTGML
IAPDSRGGATGVAAKAFTHATAKWPWLADRVRAAAGSGVHVVRLSYGRLGDTIVEPDVER
ATHDAGVLLGVDLNGRVRDHLIQRWDGSLPPPTPAYRAALTGFTDAVAAQDGLTVVGGWV
AGTGLASIVTHAREATAGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggggcggtggggtggtttcgacaggctcaaccaccggaggcggctcagccgac
gcgccccccgagaaggtcgacgccgtcgtcgtcggcggcggtatcggcgggctcaccgcc
gcccgcacgctcgcgcgacgcgggctgcgcgtcgtcgtgctggaggccgacgccgtcccc
ggcgggccggtgcgcggcgggcacttcgcctcgctgccgtcggtgccgatcgacgtcggc
gtggagtcgtacgctgcgcgcggtctggccgtgacggaactcgcggccgagctggggctc
accggcgccgtgcccgccgccgcgcaggcgtgggggtactcggccgggcgcacgttcccg
ctgccgaaggcggggatgctcggcatcccgtcgacaccctgggccgcggacgtgcgccgc
gccatcggctggcccggcgtgctgcgcgcctcgctggaccgggtgctgcccgcgcggttc
gtggacacgtcgtccctcggggcgctggtgcgctcgcgcatggggcggcgcgtcgcggac
cggctcgtgaccctcatcgcggccggggtgcactcggccacggtcgactcgctggacgtc
tccgcggtggcgccgggcctgctcgacgcgttcgcccgcgagggctcgctgtctcgcgcg
gtggggtcgttgcgcaaggcggcgcccgccggggcgatggtccgcggcgtcgacggcggc
atccacgcgatcatcgaggcgatggtcggcgagctcaacgccgacgccgagcactgggcg
cccgacgacgccctcgccaccggggcgggcgtgcggtgcggcgagaaggtcgtggggatc
gagcgcgtcgcggggctcggcggatccgccgccgcgggccgctggcaggtcacgacggcg
acaggcaccgtcgtcgtcgccccgaagctcgtggtcgcgacgcccgcggtcgccccgctg
ctcgcccccgtcgtcggcgtcgacccaccgaccgcgacgcccggcgcacccatcgccctg
gtcgcactgctgctcgacgcgcccgagctcgacgccgccccgcgcggcaccggcatgctc
atcgccccggactcgcgcggcggtgccacgggggtggcggccaaggcgttcacgcacgcg
acggccaagtggccgtggctcgccgaccgcgtccgcgccgccgccggttccggcgtgcat
gtggtgcgcctgagctacggccgcctgggcgacacgatcgtcgagcccgacgtcgagcgc
gccacccacgacgcgggcgtcctgctcggcgtcgacctgaacggccgggtgcgcgaccac
ctgatccagcgctgggacgggtcgctgccaccccccacgcccgcctaccgggccgcgctg
acggggttcaccgacgcggtcgccgcccaggacggcctcaccgtcgtcggcggctgggtc
gcgggcacgggcctggcgtcgatcgtgacgcacgcacgcgaggcgaccgcaggtctgtag

DBGET integrated database retrieval system