KEGG   Xylanimonas cellulosilytica: Xcel_3250Help
Entry
Xcel_3250         CDS       T01135                                 

Definition
FAD dependent oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xce00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3605502..3607001
Genome map
AA seq 499 aa AA seqDB search
MSGGGGVVSTGSTTGGGSADAPPEKVDAVVVGGGIGGLTAARTLARRGLRVVVLEADAVP
GGPVRGGHFASLPSVPIDVGVESYAARGLAVTELAAELGLTGAVPAAAQAWGYSAGRTFP
LPKAGMLGIPSTPWAADVRRAIGWPGVLRASLDRVLPARFVDTSSLGALVRSRMGRRVAD
RLVTLIAAGVHSATVDSLDVSAVAPGLLDAFAREGSLSRAVGSLRKAAPAGAMVRGVDGG
IHAIIEAMVGELNADAEHWAPDDALATGAGVRCGEKVVGIERVAGLGGSAAAGRWQVTTA
TGTVVVAPKLVVATPAVAPLLAPVVGVDPPTATPGAPIALVALLLDAPELDAAPRGTGML
IAPDSRGGATGVAAKAFTHATAKWPWLADRVRAAAGSGVHVVRLSYGRLGDTIVEPDVER
ATHDAGVLLGVDLNGRVRDHLIQRWDGSLPPPTPAYRAALTGFTDAVAAQDGLTVVGGWV
AGTGLASIVTHAREATAGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggggcggtggggtggtttcgacaggctcaaccaccggaggcggctcagccgac
gcgccccccgagaaggtcgacgccgtcgtcgtcggcggcggtatcggcgggctcaccgcc
gcccgcacgctcgcgcgacgcgggctgcgcgtcgtcgtgctggaggccgacgccgtcccc
ggcgggccggtgcgcggcgggcacttcgcctcgctgccgtcggtgccgatcgacgtcggc
gtggagtcgtacgctgcgcgcggtctggccgtgacggaactcgcggccgagctggggctc
accggcgccgtgcccgccgccgcgcaggcgtgggggtactcggccgggcgcacgttcccg
ctgccgaaggcggggatgctcggcatcccgtcgacaccctgggccgcggacgtgcgccgc
gccatcggctggcccggcgtgctgcgcgcctcgctggaccgggtgctgcccgcgcggttc
gtggacacgtcgtccctcggggcgctggtgcgctcgcgcatggggcggcgcgtcgcggac
cggctcgtgaccctcatcgcggccggggtgcactcggccacggtcgactcgctggacgtc
tccgcggtggcgccgggcctgctcgacgcgttcgcccgcgagggctcgctgtctcgcgcg
gtggggtcgttgcgcaaggcggcgcccgccggggcgatggtccgcggcgtcgacggcggc
atccacgcgatcatcgaggcgatggtcggcgagctcaacgccgacgccgagcactgggcg
cccgacgacgccctcgccaccggggcgggcgtgcggtgcggcgagaaggtcgtggggatc
gagcgcgtcgcggggctcggcggatccgccgccgcgggccgctggcaggtcacgacggcg
acaggcaccgtcgtcgtcgccccgaagctcgtggtcgcgacgcccgcggtcgccccgctg
ctcgcccccgtcgtcggcgtcgacccaccgaccgcgacgcccggcgcacccatcgccctg
gtcgcactgctgctcgacgcgcccgagctcgacgccgccccgcgcggcaccggcatgctc
atcgccccggactcgcgcggcggtgccacgggggtggcggccaaggcgttcacgcacgcg
acggccaagtggccgtggctcgccgaccgcgtccgcgccgccgccggttccggcgtgcat
gtggtgcgcctgagctacggccgcctgggcgacacgatcgtcgagcccgacgtcgagcgc
gccacccacgacgcgggcgtcctgctcggcgtcgacctgaacggccgggtgcgcgaccac
ctgatccagcgctgggacgggtcgctgccaccccccacgcccgcctaccgggccgcgctg
acggggttcaccgacgcggtcgccgcccaggacggcctcaccgtcgtcggcggctgggtc
gcgggcacgggcctggcgtcgatcgtgacgcacgcacgcgaggcgaccgcaggtctgtag

DBGET integrated database retrieval system