KEGG   Xylanimonas cellulosilytica: Xcel_3253Help
Entry
Xcel_3253         CDS       T01135                                 

Definition
Uroporphyrinogen-III synthase-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Xcel_3253
Enzymes [BR:xce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Xcel_3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3609362..3610942
Genome map
AA seq 526 aa AA seqDB search
MTTPDLPLGDPGAASGPPAGLSPVRAEGPHADGPHTARPLAGHAEGPHADGPRTARLLAG
RTVLITRAPDRAHSLADLLERLGARVVVAPVTTTAPPASPAALDAAVRSLDDYAWVAVTS
VNAVDALRDAAARTATPLSPGLSGAGRGGAPGAPDTAGTPSGMSGAERTRAPGAPDTAGT
PSGMSGAERALPPGAPDNSLAAAQPSMGASGPRWAAVGPATSRALHAAGVPVSLEATGTA
TDLAARFPAPPNLSDPRKTPPLPASDRREDHDGLSEGRETPPLRASDTFDARELSGAQGA
MLLPAPDNEDARELSGAPGGQVRPAPDMPEGVPAVSGAQGGSPPPAPDKPGVAVTGAGRS
RRVLLPLGDLARSVLADGLRAAGWDVHAVVAYRTVPLALPDDVVDAAWGGTIDLGVVAAG
SAARELARQLGEAAPPVVAIGQPSAEAAVAAGLTVVGVAERPTDDALAAALVAAAGGTVH
GAAVLDTGDLGAADLDTAVHGAAVHGAAPTTGPASTHTAPTTRSDT
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccggacctccccctcggcgaccccggggcggcgagcggcccgcccgccggc
ctctcgccggtgcgtgctgagggcccccacgctgacggcccacacaccgcccgtcccctc
gcgggccacgctgagggcccccacgctgacggcccgcgcaccgcccgtctcctcgcgggc
cgcacggtgctcatcacgcgcgcgccggaccgtgcacactcactcgcggacctgctggag
cgcctgggcgcgcgcgtcgtcgtcgcaccggtgacgacgaccgcgccccccgcgtctccc
gcggcgctggacgcggcggtgcgatccctcgacgactacgcctgggtggccgtgacgagc
gtcaacgccgtcgacgccctgcgcgacgccgccgcccgcacggcaacccccctctccccc
ggcctgtcaggtgcagggcgcggcggggcccccggagcgcctgacaccgcgggcaccccc
tcaggcatgtcaggtgctgagcgcacccgagcccccggagcgcctgacaccgcgggcacc
ccctcgggcatgtcaggtgctgagcgtgccctgccccccggagcgcctgacaactcgttg
gcggccgcccagccgtcgatgggcgccagcgggccgcggtgggccgccgtcggcccggcg
acgtcgcgcgctctgcacgccgcgggagtcccggtatcgctggaggccaccggcacggcc
acggacctggccgcccgcttccccgccccaccgaacctgtcagacccacgcaagacccca
cccttgccagcgtctgacaggcgcgaggaccacgacgggttgtcagagggacgcgagacc
ccacccttgcgagcgtctgacaccttcgacgcgcgcgagctgtcaggcgcacagggcgcc
atgctcctcccagcgcctgacaacgaggatgcacgcgaactgtcaggcgctccgggggga
caggttcgcccagcacctgacatgcccgagggggtacccgcggtgtcaggtgcgcagggt
ggttcgccgccccctgcacctgacaagccaggggtggcggtcaccggggcggggcggagt
cggcgggtgttgttgccgctcggggaccttgcgcggagcgtgctcgccgacgggttgcgc
gccgccgggtgggacgtccacgccgtcgtcgcctatcggaccgttccgctcgcgctgccc
gacgacgtcgtcgacgcggcgtggggtgggacgatcgacctcggcgtcgtcgcggccggg
tccgcggcacgcgagcttgcccggcagctcggcgaggccgcaccgcccgtcgtcgccatc
gggcagccctccgccgaggcggccgtcgcggcgggactcaccgtcgtcggcgtcgccgag
cgtcctaccgacgacgccctcgccgccgcgctggtggcggccgcgggcggcacggtccac
ggcgctgcggtcctcgacactggggacctcggggccgcggacctcgacactgcggtccac
ggcgctgcggtccacggcgcggcaccgaccacgggcccagcgtccacgcacacagcaccg
accacgaggagtgacacgtga

DBGET integrated database retrieval system