KEGG   Xylanimonas cellulosilytica: Xcel_3254Help
Entry
Xcel_3254         CDS       T01135                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Xcel_3254
Enzymes [BR:xce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Xcel_3254
Exosome [BR:xce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Xcel_3254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3610939..3611994
Genome map
AA seq 351 aa AA seqDB search
MSTNGAAIVYRPRRLRATPRMRRLVAENRLHAADLVLPLFVKEGLSEPAPITSMPGQVQH
TLDTLRDAVEAAARAGLGGVMLFGIPAVRDAVGSQGDAPDGILQRGIAVARAAVAEVEAE
TGRPGPVVMADTCLDEFTDHGHCGVLVSTGGVVSTGSTTAGRGAVEVDNDATLERYASMA
VAQARAGAEIVAPSGMMDGQVAVIRDALDDAGFTGVSILAYSAKYASPFYGPFREAVDSA
LQGDRRTYQMDAANLREGMREADLDLAEGADIVMVKPAGSYLDVLRGVADRSDVPVAAYQ
VSGEYAMIEAAAANGWIAREASILESVTSIKRAGADIILTYWALEIAKWIK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgaacggggcagcgatcgtctaccggccgcggcggttgcgggccacgccgcgc
atgcggcggctcgtcgccgagaaccggctgcacgcggccgacctggtgctgccgctgttc
gtcaaggaagggctgagcgagcccgcgcccatcacctccatgcctgggcaggtgcagcac
acgctcgacaccctgcgcgacgccgtcgaggcggccgcccgcgcggggctcggcggcgtg
atgctgttcgggatccccgcggtgcgcgacgccgtcgggtcccagggcgacgcgcccgac
gggatcctgcagcgcgggatcgccgtcgcgcgggcggcggtggccgaggtggaggcggag
accgggcggcccgggccagtcgtcatggcggacacgtgcctggacgagttcaccgatcac
gggcactgcggggtgttggtctcgacaggcggggtggtttcgacaggctcaaccaccgcc
gggcgcggcgccgtcgaggtcgacaacgacgccacgctggagcggtacgcatcgatggcc
gtcgcgcaggcgcgcgcgggcgccgagatcgtggccccgagcggcatgatggacgggcag
gtcgccgtgatccgcgatgcgctcgacgatgccgggttcacaggcgtcagcatcctggcc
tactccgcgaagtacgcgagcccgttctacgggcctttccgcgaggctgtggacagcgcg
ctgcagggcgaccgccgcacgtaccagatggacgccgcgaacctgcgcgaagggatgcgc
gaggccgacctggacctggccgagggcgccgacatcgtcatggtcaagccagcgggctcg
tacctcgacgtgctgcgcggcgtcgccgaccgctccgacgtgcccgtcgcggcgtaccag
gtcagcggcgagtacgcgatgatcgaggctgccgcggccaacggctggatcgcccgcgag
gcgtcgatcctggagtccgtcacgagcatcaagcgcgccggcgcggacatcatcctcacc
tactgggccctggagatcgcgaagtggatcaagtga

DBGET integrated database retrieval system