KEGG   Xanthomonas citri: XCAW_00048Help
Entry
XCAW_00048        CDS       T02519                                 

Gene name
xynA
Definition
Beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xci  Xanthomonas citri
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
52529..53713
Genome map
AA seq 394 aa AA seqDB search
MHINRTNLTKPLGLLIAGLSAVCTLQAFAACGTPGTSLKRAYAQGFLLGTAVNADIVSGK
DAASAALVACHFNAVTAENVMKAEVVAPRRGVQDFSAADAFVAYAQRDRQFVVGHTLVWH
NQTPEWFFTTADGRPNTPAQQLERMRAHIAAVAGRYTGKVQAWDVVNEIIDEDGSYRSTN
WVQRVGDGDTVVRNAFAFAQRYAPDAQLYYNDFNAWRPAKREGIVRMVKMLQQAGVRIDG
VGMQGHWGLNYPSLRDIEDAIDAYAALGVKVMITELDIDVLPLTKEGQIIGTGMAHKQFQ
LPEFKRFLDPYRDGLPADVQAQLRDRYAELFALFWRKRDKIARVSVWGVSDDMSWKNDYP
VPGRTNYPLLFDRNHQPKPALDAVLAVPSATAAR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcaaccgcaccaacctcaccaaacccctgggcttgctgatcgccggcctgagt
gcagtgtgcacactgcaggccttcgccgcatgcgggacgcccggcacctcgctcaagcgg
gcgtatgcgcaagggtttttgctcgggactgccgtcaatgccgatatcgtctccggcaag
gacgcagcctctgctgcgctggtggcctgtcacttcaatgcggtcaccgcggaaaacgtg
atgaaggccgaagtggtggcgccgcgtcgtggcgtgcaggatttcagcgcggccgatgca
ttcgtggcttacgcacagcgcgatcggcagttcgtggtcggtcacaccctggtctggcac
aaccagacaccggagtggttcttcaccaccgccgatggtcggcccaatacgccggcacag
cagctggagcgcatgcgcgcgcatatcgcagcggtggccgggcgttacacgggcaaggtg
caagcctgggatgtggtcaacgaaatcatcgacgaagacggcagttaccgttcgaccaac
tgggtgcagcgcgtgggcgacggcgacacggtggtccgcaatgccttcgccttcgcacag
cgctatgcaccggatgcgcagctctactacaacgatttcaatgcatggcggccggccaag
cgcgagggcatcgtgcgcatggtcaagatgctgcagcaggccggtgtccgcatcgatggc
gtgggcatgcagggccattgggggctgaactaccccagcctgcgcgatatcgaagacgcg
atcgatgcgtacgctgcgcttggcgtcaaagtgatgatcaccgagctggacatcgatgtg
ttgccgctcaccaaggaaggccagatcatcggtaccggcatggcgcacaagcagtttcaa
ctgccggaattcaagcgttttctcgacccctatcgcgatggtttgcctgccgacgtgcag
gcgcaattgcgcgaccggtatgcggaattgttcgcgttgttctggcgcaagcgcgacaag
attgcgcgagtcagcgtgtggggcgtgagcgatgacatgtcgtggaaaaacgattacccg
gtgcctggacgcaccaattatccgctgctgttcgatcgcaatcatcaacccaaaccggcg
ttggatgcggtgttggcggtgccctccgcgaccgctgcacgctag

DBGET integrated database retrieval system