KEGG   Xanthomonas citri: XCAW_00053Help
Entry
XCAW_00053        CDS       T02519                                 

Gene name
araD
Definition
Ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
xci  Xanthomonas citri
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XCAW_00053 (araD)
Enzymes [BR:xci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     XCAW_00053 (araD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58537..59217
Genome map
AA seq 226 aa AA seqDB search
MFAHEQRQRVVALCIELSRRGYLAGTGGNVALRIDAECFAVTPSAIDYLGMQAEDIRIVR
TKDLHQLDGTRTPSVETGLHAQVMRRRPDVGCSIHTHQPVASACTLLGAPLEVTQPALRR
LLGARIPIAGYMPSGTGLLARLLARQLRPTVNAYLLRNHGVVCCGTNLQAAVTVVEALEL
VARSHLQTQIQARAAREPDLAAGLQRVLTALDSHRHTSGASSLSQT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccatgaacaacgccagcgcgtggtcgcgctgtgcatcgaactgtcgcgccgc
ggctatctggctggcaccggcggcaatgtcgccttgcgtatcgatgccgagtgtttcgcg
gtcaccccttcggcgatcgactacctgggcatgcaggccgaggatatccgcatcgtccgc
accaaggacctgcaccagctcgatggcacgcgtacgccgtcggtcgaaaccggcctgcat
gcgcaggtgatgcggcggcgcccggacgtgggctgcagcatccacacccaccagccggtc
gccagcgcctgcaccctgctgggcgcgccattggaggtgacgcaaccggcgttgcgccgg
ctgctcggcgcacggattccgatcgccggctacatgccgtcgggcaccggcctgctggcc
cgcctgctggcccggcagctgcggcccaccgtcaacgcctatctgctgcgcaatcacggc
gtggtctgctgcgggaccaacctgcaggcggccgtcaccgtggtcgaggcgttggagctg
gtcgcgcgcagccacctgcagacgcagatccaggcgcgtgccgcgcgcgagcccgacctc
gctgcgggcctgcagcgggtgttgacggcgctggattctcaccggcacacgtccggtgcg
tcctccctttcccagacatga

DBGET integrated database retrieval system