KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00292Help
Entry
XCAW_00292        CDS       T02519                                 

Gene name
speB
Definition
(RefSeq) Arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCAW_00292 (speB)
  Amino acid metabolism
   00220 Arginine biosynthesis
    XCAW_00292 (speB)
   00330 Arginine and proline metabolism
    XCAW_00292 (speB)
Enzymes [BR:xci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XCAW_00292 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
362879..363802
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPEALTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgtccctaccgacatcggcgcgggc
caccgcggtgcgcgcatgggaccggaggcgctacgcatcgccggcctgcaggaggcgctg
gtcggccgcggcgtggaggtgcgcgatctgggcaatctggatggtccgcgcaatccctgg
caggcgccgcaggccggctaccggcatctggacgaagtggtggcgtggaaccaggcgctg
atggacgccagctacgccgaactgcgtgccgggcgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctcgatcacggcggtggccaagtactgccgcgagcagggcagg
ccattgcgggtgctgtggctggatgcgcattcggatttcaacaccagtgaggtgacccct
tcgggcaacgtgcacggcatgccggtggcctgcctgtgcgggctgggccccgaggcgctg
acgcacctgggcggcagtgcgccggcgttgttgcccgagcaggtgcggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtgtacgac
atgcgctacatcgacgaagccgggatgaagcgcaccatggaagcggcattgcaggacatg
agcgccgatacgcacctgcacgtgagtttcgatgtggatttcctcgaccccagcatcgcg
ccgggcgtgggcaccacggtgcccggtggccccaactaccgcgaggcgcaactggtgatg
gagatgattgccgacaccgggcgcatggggtcgttggatatcgtcgaactcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aagtcgacgctgatgcgggattga

DBGET integrated database retrieval system