KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00292Help
Entry
XCAW_00292        CDS       T02519                                 

Gene name
speB
Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCAW_00292 (speB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XCAW_00292 (speB)
Enzymes [BR:xci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XCAW_00292 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362879..363802
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPEALTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgtccctaccgacatcggcgcgggc
caccgcggtgcgcgcatgggaccggaggcgctacgcatcgccggcctgcaggaggcgctg
gtcggccgcggcgtggaggtgcgcgatctgggcaatctggatggtccgcgcaatccctgg
caggcgccgcaggccggctaccggcatctggacgaagtggtggcgtggaaccaggcgctg
atggacgccagctacgccgaactgcgtgccgggcgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctcgatcacggcggtggccaagtactgccgcgagcagggcagg
ccattgcgggtgctgtggctggatgcgcattcggatttcaacaccagtgaggtgacccct
tcgggcaacgtgcacggcatgccggtggcctgcctgtgcgggctgggccccgaggcgctg
acgcacctgggcggcagtgcgccggcgttgttgcccgagcaggtgcggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtgtacgac
atgcgctacatcgacgaagccgggatgaagcgcaccatggaagcggcattgcaggacatg
agcgccgatacgcacctgcacgtgagtttcgatgtggatttcctcgaccccagcatcgcg
ccgggcgtgggcaccacggtgcccggtggccccaactaccgcgaggcgcaactggtgatg
gagatgattgccgacaccgggcgcatggggtcgttggatatcgtcgaactcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aagtcgacgctgatgcgggattga

DBGET integrated database retrieval system