KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00388Help
Entry
XCAW_00388        CDS       T02519                                 

Gene name
nei
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:xci00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    XCAW_00388 (nei)
Enzymes [BR:xci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     XCAW_00388 (nei)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     XCAW_00388 (nei)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461321..462151
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETTLRGLSPHLVGQRIHGVILRRPDLRRPDLRWPIPEQIERLLPGATITNVRR
RAKYLLIDTDAGGSVLLHLGMSGSLRVLPGDTLPRAHDHVDISLQSGRLLRFNDPRRFGC
LLWQSGTQAHDLLAALGPEPLSDAFTGDYLHALAQGRRAAVKTFLMDQAVVVGVGNIYAA
ESLHRAGISPLREAGKVSLERYRRLADAVKDILAYAIQRGGTTLRDFISPDGAPGYFEQE
LFVYGREGEACKQCGRVLKHATIGQRATVWCGSCQR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgcccgaggtcgaaacgacgttgcgtggcctgtcgccgcatctggttggg
cagcggatccatggcgtgatcctgcgtcggcccgatctgcgtcggcccgatctgcgttgg
ccgattcccgagcagatcgagcgcttgcttcccggcgccaccattaccaacgtgcgccga
cgtgcgaaatacttgctgatcgatacggatgccggcggcagcgtgctgttgcatctgggg
atgtccggaagtctgcgggtgctgcctggcgacacgttgccgcgggcgcacgaccatgtg
gatatcagtctgcaaagcgggcgcttgctgcgtttcaacgatccgcgtcgctttggctgc
ctgttgtggcaatccggcacacaagcccatgacttgctcgctgcgcttggtccagaacca
ttatcggatgcatttactggcgattatctccacgcgctggcacaggggcggcgcgctgcc
gtcaagacctttttgatggatcaggccgtggttgtcggagttggaaatatctacgctgcc
gaaagcctgcatcgggcgggaatcagtccgttgcgcgaggcggggaaggtctcgctggag
cgttatcggcgtctggctgatgcagtgaaagacatcctggcgtatgccatccagcgcggt
ggaaccacattgcgcgacttcatcagccccgatggtgcgcccggctatttcgagcaggaa
ctttttgtttatgggcgcgagggcgaggcctgcaaacagtgtggacgggtcttgaaacac
gcgacgatcggtcaacgcgctacggtgtggtgcgggagctgtcagcgataa

DBGET integrated database retrieval system