KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00392Help
Entry
XCAW_00392        CDS       T02519                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00240  Pyrimidine metabolism
xci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    XCAW_00392 (tdk)
Enzymes [BR:xci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     XCAW_00392 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 KdpD
Motif
Other DBs
NCBI-ProteinID: AGI06211
Position
complement(467324..467953)
Genome map
AA seq 209 aa AA seqDB search
MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAGSGVVASRIGLRADGR
IFERDTELQQLVERDIHNDGALHCVLVDEAQFLSRAQVWQLSEVVDRLRIPVLCYGLRTD
FRGELFEGSQFLLAWADELEEIKTICHSGSKATMTVRVDAHGHAVQDGPQVEIGGNERYV
SVSRAEFKKIMRGEGRIDPLQIALPLPVA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttctactattcggcaatgaatgccggcaagaccaccaccttgctg
caatcggcgcacaactaccgcgagcgcggcatgcgcacgctgatccttacgcccaagctc
gaccaccgcgccggcagcggcgtggtcgcctcgcgaatcggcctgcgcgcggacgggcgt
atcttcgagcgcgacaccgagctgcaacagctggtcgaacgcgacatccacaacgacggc
gcgttgcactgcgtgctggtggacgaagcgcaattcctcagccgcgcccaggtctggcag
ttgagcgaggtggtcgaccgcctgcgcattccggtgctgtgctacggcctgcgcaccgat
tttcgcggcgagctgttcgagggcagccagttcctgctggcctgggccgacgagctggaa
gagatcaagaccatctgccacagcggcagcaaggcgaccatgaccgtgcgcgtggatgcg
cacgggcacgcggtgcaggacggcccgcaggtggagatcggcggcaacgagcgctatgtg
tcggtcagccgggccgagttcaagaagatcatgcgcggcgaaggccgcatcgatccgcta
cagatcgccttgccgctgccggttgcctag

DBGET integrated database retrieval system