KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00550Help
Entry
XCAW_00550        CDS       T02519                                 

Gene name
glgB1
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCAW_00550 (glgB1)
Enzymes [BR:xci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XCAW_00550 (glgB1)
Exosome [BR:xci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCAW_00550 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654094..656289
Genome map
AA seq 731 aa AA seqDB search
MSGVMTAVSNRWDSGVVRALAEARHGDAFAVLGAHPSDKGRLLRTYLPGADRVGAVLDDG
QVVALDAGPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAFGPQLSDFDLHLISEGHH
LQLADALGANVVEVEGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQSGVWELF
VPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATR
ARRQAHDAPMSIYEIHAGSWLREAGVDLDWDGLADRLIPYVADMGFTHVELMPVSEHPFG
GSWGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTA
LYEHADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRDY
SRNAGEWIPNIHGGRENYETIAFLRRLNEVVREHTPGAVMIAEESTAFPGVTAEVAHGGL
GFHYKWNMGWMHDTLHYAGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSL
LGRMPGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDPRHR
GVQTLVRDLNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVIN
FTPVVQHAYRIGVPQGGQWREVFNSDAGIYGGSNLGNGGSVTAEQQSMHGHAQSLPLLLP
PLGAIVLTPYG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagtaatgacagcagtgagcaatcgatgggattccggcgtggtacgcgccctg
gcagaggcgcgccacggcgacgcgtttgcggtcttgggtgcgcacccgtccgacaagggg
cgcttgttgcgcacctatctacccggcgccgaccgcgtcggtgcggtgctcgacgatggg
caggtggtggcgctggacgccggcccggagccgggcctgtttgccggcgagttgccggcg
cacggcgggtatcgcctgcgcatcggctggcccggtggcgagcaggagaccgcagacccg
tatgcgttcggcccgcagctcagcgacttcgacctgcacctgatcagcgaaggccaccat
ctgcagctggccgacgcgctgggcgccaacgtggtcgaggtggagggcgtacgcggcacg
cgctttgccgtctgggcaccgaatgcctcgcgcgtggcggtggtgggcgacttcaacagc
tgggacgcgcgccgtcatccgatgcggctgcggcatcagtccggcgtgtgggaattgttc
gtgcccgacgtcggccccggcgcgcattacaagtaccagctgcgtggtccgcacgggcac
gagttgccggccaaggccgacccggtggcgcgccgcgcggagcttgcgccgggcactgcg
tccatcgtggccgatcccacgccgcatcagtggagcgacgacggctggatggccacgcgt
gcgcgtcgccaggcccacgacgcgccgatgagcatctacgagatccacgccggctcgtgg
ctccgcgaagcaggggttgacctggattgggatgggctggccgaccgcctgatcccgtac
gtggccgacatgggcttcacccatgtcgagttgatgccggtgagcgagcatccgttcggc
ggctcatggggttatcaaccattgggtctgttcgcgcccactgcgcgcttcggcacgccc
gatggatttgcgcgctttgtcgaccgctgccatcgcgaaggcatcggcgtgatcgtcgac
tgggtgccggcgcactttcccaccgatgcgcacgggctggcgcatttcgacggcaccgcg
ctgtacgagcatgccgacccgcgcgaaggcttccaccgcgactggaatacgctgatctac
aaccacggccgccgcgaggtgtccgggttcctgatcgccagtgcgatggaatttctgcag
cgctatcacgtggacggccttcgcgtggatgcggtggcctcgatgctgtaccgcgattac
agccgcaacgccggcgagtggatacccaacatccacggcgggcgcgagaactacgagacc
atcgcattcctgcgccggctcaacgaggtggtgcgcgagcacaccccgggcgcggtaatg
attgccgaagaatccactgcgtttcccggtgtcaccgccgaggtggcgcacggcggcctg
ggctttcactacaagtggaacatgggctggatgcacgacaccctgcattacgccgggttg
gacccgatctatcgccgctaccatcatggcgagctgactttcagcatggtctatgcgtat
tcggagcgcttcgtgctgccgatctcgcacgacgaagtggtgcacggcaagggttcgttg
ctgggccgcatgccgggcgacgattggcaacgcttcgccaacctgcgcgcgtacttgggt
ttcatgttcacccacccgggacgcaagttgctgttcatgggctgcgaattcggccagccg
accgagtggaatcacgacgccggcctgccgtggcatttgctcgacgaccctcgccatcgt
ggggtgcagacgctggtgcgcgatttgaaccggctgtatgtccaatacccggcgctccac
gcacacgacgacgatccgtccgggtttgcctgggtggtgggcgacgatgccggcaacagc
gtggtggcgttcctgcgcaagggcaaacgcggcgacgcaccggtgctggtggtgatcaac
ttcaccccggtcgtgcaacacgcatatcgcatcggtgtgccacaaggcggccagtggcgc
gaggtgttcaatagcgacgccggcatctacggcggcagcaacctgggcaatggcggcagc
gtcaccgccgagcagcaatccatgcatgggcacgcgcaatcgctgccgctgctgttgcca
ccgctgggcgccatcgtgctgacgccgtatggctga

DBGET integrated database retrieval system