KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00610Help
Entry
XCAW_00610        CDS       T02519                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCAW_00610 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    XCAW_00610 (paaJ)
   00640 Propanoate metabolism
    XCAW_00610 (paaJ)
   00650 Butanoate metabolism
    XCAW_00610 (paaJ)
  Lipid metabolism
   00071 Fatty acid degradation
    XCAW_00610 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    XCAW_00610 (paaJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCAW_00610 (paaJ)
   00310 Lysine degradation
    XCAW_00610 (paaJ)
   00380 Tryptophan metabolism
    XCAW_00610 (paaJ)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCAW_00610 (paaJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCAW_00610 (paaJ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCAW_00610 (paaJ)
Enzymes [BR:xci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XCAW_00610 (paaJ)
Exosome [BR:xci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCAW_00610 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
723531..724826
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLSELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSGEAWALAHGHTPMAYLRDAQV
AAIDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatc
ccgttctgtcgtcagaacaccgcgtacgcggacgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgttggtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcactccgcggactggaacctggcgcgcgaagcggcgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcaacgcgcctgcggcaccagcctg
gattcggtcatcaccatcgccaacaagatcgcgctggggcagatcgactctggcatcggc
ggcggctccgacaccacctccgaagtgccgatcgtctatggcaagaaactgcgcgcacgg
ctgctggccgccaaccgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggg
ttcaagctgagcgagctcaagcccgagttccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcctcgcaccacaagctggctgcggcctatgagcgcgggttcttc
gattcgctcatcgcgccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaaactcgcgaccttgcgcccggccttcgacaagacctccggccgtggcacg
ttgaccgctgccaattccaccccgctcaccgatggcgccgccgcggtgctgctctccggc
gaagcctgggcgttggcgcatggccacacgccgatggcctacctgcgcgatgcacaggtg
gcggcaatcgactttgtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccg
cagatgctggcgcgccagggcctgaccctgcaggacttcgatatctacgaaatccacgag
gccttcgccgcgcaggtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgc
aaccggctgggcctggacgcgccgctgggccgcatcgacccggacaagatcaatccgctg
ggctcgtcgctggccaccggccatccattcgccgccactggcgcacgcgtggtcgccacc
gctgccaagcagttggaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgcc
ggcggcatgggcgtggtggccatcgtcgagcgctga

DBGET integrated database retrieval system