KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00613Help
Entry
XCAW_00613        CDS       T02519                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00860  Porphyrin and chlorophyll metabolism
xci01100  Metabolic pathways
xci01110  Biosynthesis of secondary metabolites
xci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XCAW_00613 (hemD)
Enzymes [BR:xci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XCAW_00613 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Tom5
Motif
Other DBs
NCBI-ProteinID: AGI06432
Position
complement(727384..728163)
Genome map
AA seq 259 aa AA seqDB search
MTGLAHSDAAWTLISLRPSGEHAPLRRAVARHGGRVLALSPWRLQTHDTAQARDALRQAL
AAPIAIFTSPAAVQAAHRLAPLQRPAQAHWVSVGDGTARALHACGIDTVVRPARMDSEGL
LALPLLQAPLQAVGLITAPGGRGMLAPTLQQRGARIVRADVYQRVPLRLRASAIQALSLA
LPRSVLALSSAEALTLVLQQLPAELVAAWQQRPVVASSDRMLDAAHAAGFAHGMRAEGPL
PLQLAAAAEAAIMTPPRPC
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccttgcccattccgatgctgcctggaccctgatctcgctgcgccccagcggt
gaacatgcgccgctacggcgggcagttgcgcggcatggcggacgggtactagcgctgtcg
ccatggcgcttgcagacccatgacaccgcacaagcgcgagacgcgctgcggcaggcgctg
gcagcaccgattgcgattttcaccagcccggcggcagtgcaggcggcgcatcgtctggcg
ccgctgcagcgcccggcgcaggcgcactgggtcagcgtgggcgacggcactgcgcgcgca
ttgcacgcctgcggcatcgacaccgtggtgcggccggcgcgcatggacagcgaaggcctg
cttgcgctgccgttgctgcaggcgccgctacaggccgtcgggctgatcactgcccccggc
ggacgcggcatgctggcgccaacgctgcagcagcgcggtgcgcgcatcgtgcgtgccgat
gtctatcaacgcgtcccgctgcgcttgcgcgcctcggccatccaggcgttgtcgcttgca
ctgccgcgcagcgtgctggcgctcagtagcgccgaagcgctgacgctggttctgcaacag
ctgcctgccgaactggtcgctgcgtggcaacagcgtccggtcgtggcatccagcgatcgt
atgctcgacgccgcacatgccgccggcttcgcgcatggcatgcgcgcagaaggcccgttg
ccgctgcagctcgccgctgctgctgaggcggcgatcatgacaccaccgcgaccttgctga

DBGET integrated database retrieval system