KEGG   Xanthomonas citri: XCAW_00613Help
Entry
XCAW_00613        CDS       T02519                                 

Gene name
hemD
Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xci  Xanthomonas citri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xci00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(727384..728163)
Genome map
AA seq 259 aa AA seqDB search
MTGLAHSDAAWTLISLRPSGEHAPLRRAVARHGGRVLALSPWRLQTHDTAQARDALRQAL
AAPIAIFTSPAAVQAAHRLAPLQRPAQAHWVSVGDGTARALHACGIDTVVRPARMDSEGL
LALPLLQAPLQAVGLITAPGGRGMLAPTLQQRGARIVRADVYQRVPLRLRASAIQALSLA
LPRSVLALSSAEALTLVLQQLPAELVAAWQQRPVVASSDRMLDAAHAAGFAHGMRAEGPL
PLQLAAAAEAAIMTPPRPC
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccttgcccattccgatgctgcctggaccctgatctcgctgcgccccagcggt
gaacatgcgccgctacggcgggcagttgcgcggcatggcggacgggtactagcgctgtcg
ccatggcgcttgcagacccatgacaccgcacaagcgcgagacgcgctgcggcaggcgctg
gcagcaccgattgcgattttcaccagcccggcggcagtgcaggcggcgcatcgtctggcg
ccgctgcagcgcccggcgcaggcgcactgggtcagcgtgggcgacggcactgcgcgcgca
ttgcacgcctgcggcatcgacaccgtggtgcggccggcgcgcatggacagcgaaggcctg
cttgcgctgccgttgctgcaggcgccgctacaggccgtcgggctgatcactgcccccggc
ggacgcggcatgctggcgccaacgctgcagcagcgcggtgcgcgcatcgtgcgtgccgat
gtctatcaacgcgtcccgctgcgcttgcgcgcctcggccatccaggcgttgtcgcttgca
ctgccgcgcagcgtgctggcgctcagtagcgccgaagcgctgacgctggttctgcaacag
ctgcctgccgaactggtcgctgcgtggcaacagcgtccggtcgtggcatccagcgatcgt
atgctcgacgccgcacatgccgccggcttcgcgcatggcatgcgcgcagaaggcccgttg
ccgctgcagctcgccgctgctgctgaggcggcgatcatgacaccaccgcgaccttgctga

DBGET integrated database retrieval system