KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00656Help
Entry
XCAW_00656        CDS       T02519                                 

Gene name
aceA
Definition
(RefSeq) Isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCAW_00656 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XCAW_00656 (aceA)
Enzymes [BR:xci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XCAW_00656 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769334..770527
Genome map
AA seq 397 aa AA seqDB search
MSTTLQSAEQLQQDWSNNPRWAGIARNYSAADVARLRGTVHVEHSLARLGAEKLWNSLHA
TPFVNALGALTGNQAMQQIKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNHSMFHLAH
GYARRQMSAFVELQQAEFEAAEMGFTAVKHQREVGTG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactacactgcaaagcgccgaacaactgcagcaggactggtccaacaaccctcgc
tgggccggcatcgcccgcaattacagcgctgccgatgtggcgcgcctgcgtggcaccgtg
catgtcgagcattcgctggcacgcctgggtgcagaaaaactgtggaattccctgcatgcc
acaccgttcgtcaatgcgctgggcgcgctgaccggcaaccaggccatgcaacagatcaag
gccggcctgaaggcgatttacctgagcggttggcaggttgccgccgatgccaatctggcc
gggcagatgtatccggatcaatcgctatacccggccgattcggtgccggcggtggtcaag
cgcatcaacaataccttgctgcgcgccgaccagctccatcatgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggtttcggcggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggtgcggccggtgtgcacttcgaagac
cagctggcctcggtcaagaaatgcggccatatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggccgccgatgtgctgggcgtgccgacg
gtgctgatcgcgcgcacagacgccgaagccgccgacctgatcaccagcgatgtggatgcc
aacgatcaaccgttcaccaccggcgagcgtacggtcgaaggcttcttcaagacccgcaat
ggcctggaccaggcaatcagccgcggcttggcctatgccccgtacgccgatctgatctgg
tgcgaaacgggcaagccggacctggaatttgcgcgcgccttcgcacaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaactggaagaagaat
ctggacgacgccaccattgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggccggtttccatgcgttgaatcacagcatgttccatctggcgcac
ggctatgcgcgccggcagatgagcgcattcgtcgaattgcagcaggccgagttcgaggcg
gcggagatgggatttaccgcagtcaagcatcagcgcgaggtgggcaccggctag

DBGET integrated database retrieval system