KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00656Help
Entry
XCAW_00656        CDS       T02519                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCAW_00656 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XCAW_00656 (aceA)
Enzymes [BR:xci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XCAW_00656 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769334..770527
Genome map
AA seq 397 aa AA seqDB search
MSTTLQSAEQLQQDWSNNPRWAGIARNYSAADVARLRGTVHVEHSLARLGAEKLWNSLHA
TPFVNALGALTGNQAMQQIKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNHSMFHLAH
GYARRQMSAFVELQQAEFEAAEMGFTAVKHQREVGTG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactacactgcaaagcgccgaacaactgcagcaggactggtccaacaaccctcgc
tgggccggcatcgcccgcaattacagcgctgccgatgtggcgcgcctgcgtggcaccgtg
catgtcgagcattcgctggcacgcctgggtgcagaaaaactgtggaattccctgcatgcc
acaccgttcgtcaatgcgctgggcgcgctgaccggcaaccaggccatgcaacagatcaag
gccggcctgaaggcgatttacctgagcggttggcaggttgccgccgatgccaatctggcc
gggcagatgtatccggatcaatcgctatacccggccgattcggtgccggcggtggtcaag
cgcatcaacaataccttgctgcgcgccgaccagctccatcatgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggtttcggcggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggtgcggccggtgtgcacttcgaagac
cagctggcctcggtcaagaaatgcggccatatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggccgccgatgtgctgggcgtgccgacg
gtgctgatcgcgcgcacagacgccgaagccgccgacctgatcaccagcgatgtggatgcc
aacgatcaaccgttcaccaccggcgagcgtacggtcgaaggcttcttcaagacccgcaat
ggcctggaccaggcaatcagccgcggcttggcctatgccccgtacgccgatctgatctgg
tgcgaaacgggcaagccggacctggaatttgcgcgcgccttcgcacaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaactggaagaagaat
ctggacgacgccaccattgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggccggtttccatgcgttgaatcacagcatgttccatctggcgcac
ggctatgcgcgccggcagatgagcgcattcgtcgaattgcagcaggccgagttcgaggcg
gcggagatgggatttaccgcagtcaagcatcagcgcgaggtgggcaccggctag

DBGET integrated database retrieval system