KEGG   Xanthomonas citri: XCAW_00752Help
Entry
XCAW_00752        CDS       T02519                                 

Definition
Hypothetical Protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xci  Xanthomonas citri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xci00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875918..877279
Genome map
AA seq 453 aa AA seqDB search
MSDHPSPRRAPAAPPHSTTPPVAGGITRRRVLQGAAGAAVVATAGWAGRAAAQSASLPFA
GLNLSGLASNSYVENAEIGTHYRAITAQHVAAAGSCPLFRLPTTAARFTRGQGAPLNESY
CKQVQDALDNIAARGKRAIVELHDYMRLPQRVAAKSGYRRDASGAVVDARGIRVGDLAAA
ELWADTYPLRNFNYVGYLDGRDQLLKLYEYRVIGTPGCTLYNDAGLPDLWARIVNRFKQH
PAVFGWGVMNEPYQGAERNADGTVLSMAAHWQKTATACSKTIIDRDRNHFVFVCGNGYAS
ARRWQDDSMDLFDIPDPYDRIVYEAHNYLDNNGSGGGNWIGPGGRNEVIQPDTGINMVSP
FIEALQQAGKRGYLGEHGYPAGNRSAEIATTRMLAHLQAYNIPSTQWCFGPGWPDDDVLG
MSRDVGADIQAKANLAAVQAFFDVRLSSYIPPR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccatccatctccacgccgtgcaccagcggcaccgccccactccaccacgcca
ccggtcgccggcggcatcacccgccgtcgcgtcctgcaaggggcggccggcgccgcggtc
gtggccactgccggctgggcaggccgcgcagccgcgcaaagcgccagcctgccgttcgct
ggcctcaacctgtccggtttggcctccaatagttatgtggaaaacgccgagatcggcacg
cattaccgcgccatcactgcccagcatgtggccgcggcaggaagctgcccgctcttccgt
ctgccgaccaccgccgcgcgcttcacgcgtgggcagggcgcgccgttgaacgagagctac
tgcaagcaggtgcaggacgcgttggacaatatcgcagcgcgcggcaagcgcgccatcgtg
gagctgcacgattacatgcggctgccgcagcgggtggcggccaagagcggataccggcgc
gacgccagcggtgcagtcgtcgatgcgcgcggcattcgtgtgggcgatctggcggcggcc
gagctgtgggccgacacctatccgctgcgcaacttcaattacgtgggctatctggacggt
cgcgaccagctgctcaagctctacgaataccgggtgatcggaacgccggggtgcacgctc
tacaacgacgccggcctgccggatctgtgggcgcgtatcgtcaaccggttcaagcagcat
ccggcggtgttcggctggggcgtcatgaacgagccgtaccagggcgccgagcgcaatgcg
gatggcacggtgctgtcgatggccgcacattggcagaagaccgccaccgcctgctccaag
accatcatcgaccgcgatcgaaaccatttcgttttcgtgtgcggcaacggctatgccagc
gcccggcgctggcaggacgattcgatggacctgttcgacatcccggacccgtacgatcgc
atcgtgtacgaggcgcacaactatctcgacaacaacggcagcgggggcggcaactggatt
ggccccggtgggcgcaacgaggtgatccagccggataccggcatcaacatggtcagcccg
tttatcgaagcgctgcagcaggccggcaagcgcggttatctcggcgagcacggctatccg
gccggcaatcgcagcgcggagatcgccaccacgcgcatgctggcgcatctgcaggcctac
aacattcccagcacgcaatggtgcttcggccccgggtggccggacgacgacgtgcttggc
atgagccgcgacgtgggtgcggacatccaggccaaggccaatctcgccgccgtacaggcg
ttcttcgacgtgcgcctgtccagctacattccgccccgctag

DBGET integrated database retrieval system