KEGG   Xanthomonas citri: XCAW_00837Help
Entry
XCAW_00837        CDS       T02519                                 

Gene name
glgB2
Definition
Glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xci  Xanthomonas citri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xci00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965715..967874
Genome map
AA seq 719 aa AA seqDB search
MSQTLQALADGLPADAFAVLGPKLLADGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAI
DGVFEGTLAVDGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQALRRALGAQ
HLHCGDVPGVRFALWAPHAQRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPRVDAGARYK
YAVTAADGRVLLKADPVARQTELPPATASVVPSAATFAWTDAAWMANRDPAAVPGPLSIY
EVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWGYQPLGLYA
PTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMH
RDWNTLIYNYGRPEVTAYLLGSALEWIEHYHLDGLRVDAVASMLYRDYGRAEGEWVPNAH
GGRENLEAVAFLRQLNRDIATQFPGVLTIAEESTAWPGVTAAISDGGLGFTHKWNMGWMH
DTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQMPGDDWRRF
ANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQLVGDLNAA
LRRTPALYRGTHRAEGFDWSVADDARNSVLAFVRHDPDGGAPLLAVSNLTPQPHHDYHVG
VPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTLPPLATIYLQAEK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaccctgcaagccctggccgacggcttgccggccgatgcctttgcggtgctt
ggaccgaagctgctggccgatggccgccgtcaggtgcgcgtgttggccccgggtgccgag
gcgatgggcttgatcgacccccgcggcaagctgctcgcgcgcatgcaggccagcgccatc
gatggcgtcttcgaaggcactctggcggtcgatgggccgtaccggctgcgtatcgtgtgg
ccagaccgggtgcaggaggtcgaagacccgtacgcgtttgcggccacgctggacgaatcg
ctgttgctgcagatcgctgcaggcgacggccaggcgttgcgccgtgcgctgggcgcgcag
catctccactgtggcgacgtgccgggcgtgcgcttcgcgctgtgggcaccccatgcccag
cgcgtggcggtggtcggcgacttcaacggatgggacgtgcggcggcatccgatgcggcag
cgcatcggtggcttctgggaactcttcctcccgcgcgtggacgctggcgcccggtacaag
tatgccgtcaccgcagccgatgggcgggtgctgctcaaggccgacccggtggcgcggcag
accgaattgccgccggcaaccgcatcggtggtgcccagcgccgccacattcgcctggacc
gacgcggcctggatggccaaccgcgaccccgccgccgtgccggggccgctgtcgatctac
gaggtgcatgccgcgtcctggcgtcgcgacggacacaaccagccgctggactggccaacc
ctggccgagcagttgattccctatgtgcagcagctcggcttcacccatatcgaattgctg
ccgatcaccgaacacccgtttggcggttcctggggctatcagccgctgggcctgtatgcg
cccaccgcgcgccatggcagcccggacggctttgcgcagttcgtcgacgcctgccatcgc
gccggtatcggcgtgatcctggattgggtcagtgcgcactttcccgatgacgcgcacggg
ctggcccagttcgacggcgccgcgctgtatgagcatgccgacccgcgcgaaggcatgcat
cgcgactggaatacgctgatctacaactacggccggccggaagtgaccgcttacctgctg
ggcagcgcgctggaatggatcgagcattaccacctcgacggcctgcgcgtggatgcggtg
gcctcgatgctgtatcgcgactacggccgtgccgaaggcgagtgggtgcccaacgcgcat
ggcggccgcgagaatctggaggcggtcgcgttcctgcgccagctcaaccgcgacatcgcc
acgcagttccccggcgtgctcaccatcgccgaagaatcgaccgcctggccgggcgtgacc
gccgcgatcagcgatggcggcctgggcttcacgcacaaatggaacatgggctggatgcac
gacacgctgggctacatgcagcgcgatccggccgaacgtgcgcatcaccatagccagctc
accttcgggctggtgtacgcattcgacgaacgcttcgtgttgccgctctcccacgatgaa
gtggtgcacggcaccggtggcctgctcgggcagatgccgggcgacgactggcgccgcttc
gccaacctgcgcgcctatctggccctgatgtgggcgcacccgggcgacaaactgctgttc
atgggcgccgaattcgggcaatgggccgactggaatcacgaccagtcgctggattggcat
ctgctggatggcgcgcggcatcgtggcatgcagcaactggtgggcgatctcaacgccgca
ctgcgccgcacgccggcgctgtatcgcggcacccatcgcgctgaaggcttcgactggagc
gtggccgacgatgcgcgcaacagcgtgctggcgttcgtccgccacgatcctgacggtggc
gcaccgttgctggcagtgagcaacctcaccccgcaaccgcaccacgactatcacgtgggg
gtgccgcgtgccggcctctggcgcgagatcctcaacaccgacagtgcccattacggcggc
agcaacctcggcaacagcggtcgcttggcgaccgagccggtgggcatgcatgggcatgcg
caacgtctgcgcctgaccctgccgccgctggccacgatctatctgcaagcggagaaataa

DBGET integrated database retrieval system