KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00837Help
Entry
XCAW_00837        CDS       T02519                                 

Gene name
glgB2
Definition
Glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCAW_00837 (glgB2)
Enzymes [BR:xci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XCAW_00837 (glgB2)
Exosome [BR:xci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCAW_00837 (glgB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965715..967874
Genome map
AA seq 719 aa AA seqDB search
MSQTLQALADGLPADAFAVLGPKLLADGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAI
DGVFEGTLAVDGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQALRRALGAQ
HLHCGDVPGVRFALWAPHAQRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPRVDAGARYK
YAVTAADGRVLLKADPVARQTELPPATASVVPSAATFAWTDAAWMANRDPAAVPGPLSIY
EVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWGYQPLGLYA
PTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMH
RDWNTLIYNYGRPEVTAYLLGSALEWIEHYHLDGLRVDAVASMLYRDYGRAEGEWVPNAH
GGRENLEAVAFLRQLNRDIATQFPGVLTIAEESTAWPGVTAAISDGGLGFTHKWNMGWMH
DTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQMPGDDWRRF
ANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQLVGDLNAA
LRRTPALYRGTHRAEGFDWSVADDARNSVLAFVRHDPDGGAPLLAVSNLTPQPHHDYHVG
VPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTLPPLATIYLQAEK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaccctgcaagccctggccgacggcttgccggccgatgcctttgcggtgctt
ggaccgaagctgctggccgatggccgccgtcaggtgcgcgtgttggccccgggtgccgag
gcgatgggcttgatcgacccccgcggcaagctgctcgcgcgcatgcaggccagcgccatc
gatggcgtcttcgaaggcactctggcggtcgatgggccgtaccggctgcgtatcgtgtgg
ccagaccgggtgcaggaggtcgaagacccgtacgcgtttgcggccacgctggacgaatcg
ctgttgctgcagatcgctgcaggcgacggccaggcgttgcgccgtgcgctgggcgcgcag
catctccactgtggcgacgtgccgggcgtgcgcttcgcgctgtgggcaccccatgcccag
cgcgtggcggtggtcggcgacttcaacggatgggacgtgcggcggcatccgatgcggcag
cgcatcggtggcttctgggaactcttcctcccgcgcgtggacgctggcgcccggtacaag
tatgccgtcaccgcagccgatgggcgggtgctgctcaaggccgacccggtggcgcggcag
accgaattgccgccggcaaccgcatcggtggtgcccagcgccgccacattcgcctggacc
gacgcggcctggatggccaaccgcgaccccgccgccgtgccggggccgctgtcgatctac
gaggtgcatgccgcgtcctggcgtcgcgacggacacaaccagccgctggactggccaacc
ctggccgagcagttgattccctatgtgcagcagctcggcttcacccatatcgaattgctg
ccgatcaccgaacacccgtttggcggttcctggggctatcagccgctgggcctgtatgcg
cccaccgcgcgccatggcagcccggacggctttgcgcagttcgtcgacgcctgccatcgc
gccggtatcggcgtgatcctggattgggtcagtgcgcactttcccgatgacgcgcacggg
ctggcccagttcgacggcgccgcgctgtatgagcatgccgacccgcgcgaaggcatgcat
cgcgactggaatacgctgatctacaactacggccggccggaagtgaccgcttacctgctg
ggcagcgcgctggaatggatcgagcattaccacctcgacggcctgcgcgtggatgcggtg
gcctcgatgctgtatcgcgactacggccgtgccgaaggcgagtgggtgcccaacgcgcat
ggcggccgcgagaatctggaggcggtcgcgttcctgcgccagctcaaccgcgacatcgcc
acgcagttccccggcgtgctcaccatcgccgaagaatcgaccgcctggccgggcgtgacc
gccgcgatcagcgatggcggcctgggcttcacgcacaaatggaacatgggctggatgcac
gacacgctgggctacatgcagcgcgatccggccgaacgtgcgcatcaccatagccagctc
accttcgggctggtgtacgcattcgacgaacgcttcgtgttgccgctctcccacgatgaa
gtggtgcacggcaccggtggcctgctcgggcagatgccgggcgacgactggcgccgcttc
gccaacctgcgcgcctatctggccctgatgtgggcgcacccgggcgacaaactgctgttc
atgggcgccgaattcgggcaatgggccgactggaatcacgaccagtcgctggattggcat
ctgctggatggcgcgcggcatcgtggcatgcagcaactggtgggcgatctcaacgccgca
ctgcgccgcacgccggcgctgtatcgcggcacccatcgcgctgaaggcttcgactggagc
gtggccgacgatgcgcgcaacagcgtgctggcgttcgtccgccacgatcctgacggtggc
gcaccgttgctggcagtgagcaacctcaccccgcaaccgcaccacgactatcacgtgggg
gtgccgcgtgccggcctctggcgcgagatcctcaacaccgacagtgcccattacggcggc
agcaacctcggcaacagcggtcgcttggcgaccgagccggtgggcatgcatgggcatgcg
caacgtctgcgcctgaccctgccgccgctggccacgatctatctgcaagcggagaaataa

DBGET integrated database retrieval system