KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_01277Help
Entry
XCAW_01277        CDS       T02519                                 

Definition
O-Glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    XCAW_01277
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XCAW_01277
Enzymes [BR:xci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     XCAW_01277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425003..1426472
Genome map
AA seq 489 aa AA seqDB search
MGLGTVSSASAAATAVAFAATPTAVDETSPAVSSTGALRVYTSSQGATQQMRVSTAAAPA
NGHPLTEKENSIFVNPQRQFQELLGIGGAITDSSAETFAKLPKRAQRALLTAYYDPQQGI
GYTLARTTIHSSDFSSGSYTYIKEGDAALKSFSVKHDAKYRIPMLRQAIAAAGGKLTTFA
SPWSAPAFMKDSNNMLKGGKLLPEYAQAWASYYTRFIAAYEKAGIPIWGISLQNEPMAVQ
TWESMLFSAEEERDFLKHHLGPTMASAGYGERKIIVWDHNRDMMVHRAHVIFDDPEAAKY
AWGMGFHWYETWAGFEPMVENVAAVAQAYPDKHLLLTEAAVEKFDPAKLQYWPNGERYGT
AIINDLNHGAVGWTDWNILLDQHGGPNHVGNYCFAPVHADTRTGEVIYTPSYWYIGHFSK
FIRPGARRVSSASSRSNLATTAFLNTDGSLAMVVMNAGDVAIAYNLYVGEASSTLEIPAH
AIQTVVLAQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggcacagtgagcagcgcgagtgcagcagcgacggctgttgcattcgcagcg
acgccaacagcggtagatgagacctcgccagcggtgagcagcactggtgcactgcgcgtc
tacaccagttctcaaggtgccacgcagcagatgcgcgtcagcacggctgctgctcctgcc
aacgggcatccgctgaccgaaaaagaaaactccatcttcgtcaatccgcaacggcaattt
caggaactgttgggcatcggtggcgcgatcaccgattccagcgcagagacctttgccaag
ctgcccaagcgtgcgcaacgtgcgctgctcacggcgtactacgatccgcagcagggcatt
ggctacacgctggcgcgtaccaccatccatagctcggatttcagcagcggcagctacacc
tacatcaaggagggcgatgcggcgctgaagagtttttcggtcaagcacgatgccaagtac
cgcatcccgatgttgcgccaggcgattgcggcggccggcggcaagctcaccacgtttgcc
agcccatggagcgcgccggccttcatgaaagacagcaacaacatgctcaagggcggcaag
ctattgcccgagtacgcgcaggcctgggcaagctactacacgcggtttatcgcggcatac
gaaaaagcgggcatcccgatctggggcatcagcctgcagaacgagccgatggcggtgcag
acctgggagtcgatgctgttttcggccgaggaagagcgcgacttcttgaagcatcatctt
gggcccaccatggccagcgccggctacggcgagcgcaagatcatcgtgtgggaccacaac
cgcgacatgatggtgcaccgcgcgcatgtgatcttcgatgacccggaggcggcaaaatat
gcatggggcatgggcttccattggtatgaaacctgggccggattcgagccgatggtggag
aacgtggcggcagtggcgcaggcgtacccggacaagcacttgctgttgaccgaagcggcg
gtggaaaagttcgacccggccaaattgcagtattggcccaatggcgaacgctacggcacg
gccatcatcaacgacctcaatcatggcgcagtgggctggacggactggaacattctgctc
gaccagcatggtgggccgaaccacgtgggcaattactgctttgcgccggtgcatgccgat
acgcgcacgggcgaggtgatctatacgccgagctattggtatatcggccacttttccaaa
ttcatccggccgggcgcacggcgggtcagctcagccagcagccgtagcaatctggcgacc
acggcgttcctcaacaccgatggcagcctggccatggtggtcatgaatgccggcgacgtt
gcgattgcttacaacctgtatgtgggcgaggcatccagtacgttggagattccggcgcat
gcgatccagaccgtggtattggcgcagtaa

DBGET integrated database retrieval system