KEGG   Xanthomonas citri: XCAW_01277Help
Entry
XCAW_01277        CDS       T02519                                 

Definition
O-Glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xci  Xanthomonas citri
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:xci00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xci00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425003..1426472
Genome map
AA seq 489 aa AA seqDB search
MGLGTVSSASAAATAVAFAATPTAVDETSPAVSSTGALRVYTSSQGATQQMRVSTAAAPA
NGHPLTEKENSIFVNPQRQFQELLGIGGAITDSSAETFAKLPKRAQRALLTAYYDPQQGI
GYTLARTTIHSSDFSSGSYTYIKEGDAALKSFSVKHDAKYRIPMLRQAIAAAGGKLTTFA
SPWSAPAFMKDSNNMLKGGKLLPEYAQAWASYYTRFIAAYEKAGIPIWGISLQNEPMAVQ
TWESMLFSAEEERDFLKHHLGPTMASAGYGERKIIVWDHNRDMMVHRAHVIFDDPEAAKY
AWGMGFHWYETWAGFEPMVENVAAVAQAYPDKHLLLTEAAVEKFDPAKLQYWPNGERYGT
AIINDLNHGAVGWTDWNILLDQHGGPNHVGNYCFAPVHADTRTGEVIYTPSYWYIGHFSK
FIRPGARRVSSASSRSNLATTAFLNTDGSLAMVVMNAGDVAIAYNLYVGEASSTLEIPAH
AIQTVVLAQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggcacagtgagcagcgcgagtgcagcagcgacggctgttgcattcgcagcg
acgccaacagcggtagatgagacctcgccagcggtgagcagcactggtgcactgcgcgtc
tacaccagttctcaaggtgccacgcagcagatgcgcgtcagcacggctgctgctcctgcc
aacgggcatccgctgaccgaaaaagaaaactccatcttcgtcaatccgcaacggcaattt
caggaactgttgggcatcggtggcgcgatcaccgattccagcgcagagacctttgccaag
ctgcccaagcgtgcgcaacgtgcgctgctcacggcgtactacgatccgcagcagggcatt
ggctacacgctggcgcgtaccaccatccatagctcggatttcagcagcggcagctacacc
tacatcaaggagggcgatgcggcgctgaagagtttttcggtcaagcacgatgccaagtac
cgcatcccgatgttgcgccaggcgattgcggcggccggcggcaagctcaccacgtttgcc
agcccatggagcgcgccggccttcatgaaagacagcaacaacatgctcaagggcggcaag
ctattgcccgagtacgcgcaggcctgggcaagctactacacgcggtttatcgcggcatac
gaaaaagcgggcatcccgatctggggcatcagcctgcagaacgagccgatggcggtgcag
acctgggagtcgatgctgttttcggccgaggaagagcgcgacttcttgaagcatcatctt
gggcccaccatggccagcgccggctacggcgagcgcaagatcatcgtgtgggaccacaac
cgcgacatgatggtgcaccgcgcgcatgtgatcttcgatgacccggaggcggcaaaatat
gcatggggcatgggcttccattggtatgaaacctgggccggattcgagccgatggtggag
aacgtggcggcagtggcgcaggcgtacccggacaagcacttgctgttgaccgaagcggcg
gtggaaaagttcgacccggccaaattgcagtattggcccaatggcgaacgctacggcacg
gccatcatcaacgacctcaatcatggcgcagtgggctggacggactggaacattctgctc
gaccagcatggtgggccgaaccacgtgggcaattactgctttgcgccggtgcatgccgat
acgcgcacgggcgaggtgatctatacgccgagctattggtatatcggccacttttccaaa
ttcatccggccgggcgcacggcgggtcagctcagccagcagccgtagcaatctggcgacc
acggcgttcctcaacaccgatggcagcctggccatggtggtcatgaatgccggcgacgtt
gcgattgcttacaacctgtatgtgggcgaggcatccagtacgttggagattccggcgcat
gcgatccagaccgtggtattggcgcagtaa

DBGET integrated database retrieval system