KEGG   Xanthomonas citri: XCAW_02199Help
Entry
XCAW_02199        CDS       T02519                                 

Gene name
egl2
Definition
cellulase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xci  Xanthomonas citri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xci00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2434707..2436467)
Genome map
AA seq 586 aa AA seqDB search
MTIFKTLLTSLMVVSPVLACAAETPGRQEAMAASDAIHVNQLGYLPGSAKLAIVGLPPQG
AANRSDRFTVEDAQGRSVLQGILQPAALWSPAGQQARVADFSGLRAAGTYRLKVDGLPAS
ETFAINAHAYQPLVDAALKAFYFNRASTALPARYAGRYARAAGHPDTQVRIHRSAASATR
PTDSVISAPKGWYDAGDYNKYVVNSGISTYTLLAAYEQYPAFFKSKPLTIPDDVPGVPGI
LQEAWWNLDWMLAMQDPADGGVYHKLTDKQFDGLVMPDQATQQRYVVMKTTAASLDFAAV
MAVASRVYAPFEQQYPGLSARMLKASRAAWAWAKQHPDVIYQQPSDVRTGGYDDAHLDDE
FAWAAAELYIATGEDGFYDAMIARNVPATVPSWGNVGGLAWMSLAGHREQLTPHADRARI
AREITGLAQQLADTWQSSAWRLAMNDGDFVWGSNAGGLNRAMMLLQGYRLTQQRQFLDAA
QSQLDYILGRNPLGLSFVTGIGKRTPMHIHHRPSEADGIEAPVPGWLVGGPQPGQQDAKE
CKVPYPSKRPALSYLDNFCSYSTNEVAINWNAPLVYVSAAIEASTR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgactatcttcaagactctgctcaccagcctgatggtcgtttcgccagtgctcgcctgc
gctgccgagacgcccggcaggcaggaggccatggcggccagcgacgccatccacgtcaac
cagctgggctatctgccgggctcggcaaaactggcgatcgtcgggctgccgccgcagggc
gccgcgaaccgttcggaccgcttcacggtcgaagatgcacagggacgcagcgtgttgcag
ggaatcctgcagccggccgcgctgtggtcgccggccggtcagcaggcgcgggtggcggat
ttttccgggctgcgtgcggccgggacctatcggttgaaggtcgacgggctgccggcatcg
gaaaccttcgccatcaacgcgcatgcctaccagcccctggtcgatgcagcgttgaaggcg
ttctacttcaaccgtgccagcaccgcactgccggcacgctacgccgggcgctatgcgcgc
gcggccgggcacccggatacgcaggtgcgcatccatcggtccgcagcgtctgcgacgcgt
ccaaccgatagcgtgatcagcgcgcccaaaggttggtacgacgcgggcgactacaacaag
tacgtcgtcaattccggcatcagcacctacaccttgctggcggcctacgagcagtatccg
gcgttcttcaaatccaaaccgttgaccatccccgacgatgtgcccggcgtgcccggcatc
ctgcaggaggcctggtggaatctggactggatgctcgccatgcaggacccggccgatggc
ggcgtgtaccacaagctcaccgacaagcagttcgatggcttggtgatgccggatcaggcc
acgcagcagcgctacgtggtgatgaagacgactgccgcgagcttggacttcgctgcggtg
atggccgtggccagccgcgtgtatgcgccgtttgaacagcagtatccgggtctgtcggcg
cgcatgttgaaagcctcgcgtgctgcgtgggcgtgggcgaagcagcatccggatgtgatc
taccagcagcccagcgacgtgcgcaccggcggttacgacgatgcgcacctggacgacgaa
ttcgcctgggcggcggccgagttgtacatcgccaccggcgaggatgggttctacgatgcg
atgatcgcgcgcaacgtgccggccaccgtgccgtcgtggggcaatgtcggtggcctggcc
tggatgtcgttggccgggcatcgcgagcaactcacgccgcatgccgatcgcgcgcggatc
gcacgggagatcaccggcctggcacagcagttggccgacacctggcaatcatcggcatgg
cggctggcgatgaacgatggcgatttcgtgtggggcagcaacgcaggggggctcaaccgc
gcgatgatgctgctacagggctaccggctgacgcagcagcggcaatttctggatgcggcg
caatcgcagctggactacatcctgggccgcaatccgctggggctgtccttcgttacggga
ataggcaaacgcaccccgatgcatatccatcaccgcccctccgaggccgatggtatcgaa
gcgccggtaccgggttggctggtcggcggcccgcagccggggcagcaggatgccaaggag
tgcaaggtgccgtatccctccaaacggccggcgttgtcgtacctggacaacttctgcagc
tactccaccaacgaggtggcgatcaactggaatgcgccgctggtgtatgtgagcgcggcg
atcgaggcgtcgacgcgctga

DBGET integrated database retrieval system