KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_02572Help
Entry
XCAW_02572        CDS       T02519                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00340  Histidine metabolism
xci01100  Metabolic pathways
xci01110  Biosynthesis of secondary metabolites
xci01230  Biosynthesis of amino acids
Module
xci_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    XCAW_02572 (hisD)
Enzymes [BR:xci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     XCAW_02572 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGI08355
Position
complement(2882458..2883753)
Genome map
AA seq 431 aa AA seqDB search
MKILDWSQLDGAAQTDALTRPVQTVAARTRDAVAALIADVRTRGDAALREITAHFDGVSL
DSFAVSEAEFAAAEAAVPPELRQAMQDAVARIDTFHRAGMSGGYAVETAPGVVCEKIVRP
IGRVGLYVPAGSAPLPSTALMLGVPARLAGCREVVLCTPPRKDGSVDPAVLVAARLTGVR
RVFKLGGAQAIAAMAYGTESLPSCDKLFGPGNSYVTEAKQQVAQSGAAAIDMPAGPSEVL
VIADAGAQPAFVAADLLSQAEHGPDSQVLLLSDSDALIGAVRAQLEVQLAQLSRADIARQ
ALAQSRLIKVQTLDEAFAISNRYAPEHLILALREPRGWLAQVEAAGSVFLGDYTPEALGD
YCSGTNHVLPTSGAARAYSGVSVASFQNMVSVQAASKAGIDGIGACALVLARAEGLDAHA
NAVALRMGVAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctcgattggtcccaactcgacggtgccgcacagaccgacgcattgacccgc
ccggtgcagaccgtggccgcacgaacgcgcgatgcggtcgccgcgttgattgccgacgta
cgcacgcgcggcgatgccgcattgcgcgagatcaccgcgcatttcgatggcgtgtcgctg
gacagcttcgcagtgagcgaagccgaattcgccgccgccgaagcggccgtcccaccggag
ctgcgccaggccatgcaggatgcggttgcacgcatcgacaccttccaccgcgccggtatg
agcgggggctatgcggtggaaaccgcgcccggtgtggtgtgcgaaaagatcgtgcgtccg
atcggtcgtgtcggtttatacgtgccggccggcagcgcgccgttgccgtcgacggcattg
atgctcggcgtgcctgcgcgtctggccggatgccgcgaggtggtgttgtgcacgccgccg
cgcaaggacggcagcgtggacccggcggtgctggtggccgcgcggctcaccggcgtgcgc
cgcgtgttcaagctcggcggtgcgcaggcgatcgcggcgatggcgtatggcaccgaatcg
ctgcccagctgcgacaagctgttcggcccgggcaacagctatgtcaccgaagccaagcag
caggtggcccagtccggtgcggcggcgatcgacatgccggccggcccctcggaagtcttg
gtgatcgccgatgcgggcgcgcaaccggcgttcgtggctgctgacctattgtcgcaggcc
gaacacgggcccgattcgcaggtgctgttgctctccgacagcgacgcgttgatcggtgcg
gtgcgagcgcagctggaagttcagctggcgcaactgtcgcgtgccgacattgcgcgccag
gcgctggcgcaatcgcggctgatcaaggtgcagacgctggatgaggcgtttgcgatcagt
aatcgctatgcgccggaacatctgattcttgcgctgcgcgaaccgcgcggatggttggcg
caagtcgaagcggccggatcggtgtttctcggcgattacacgcccgaagcgcttggcgac
tactgcagcggcaccaatcatgtattgccgaccagcggtgcggcgcgcgcctacagcggc
gtgagcgtggccagcttccagaacatggtcagcgtgcaggcagccagcaaggccggcatc
gacggtatcggcgcatgcgctttggtcctcgcgcgggccgaggggctggatgcgcatgcc
aacgcggtggcgctacgcatgggagtggcggcatga

DBGET integrated database retrieval system