KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_02966Help
Entry
XCAW_02966        CDS       T02519                                 

Gene name
oLE1
Definition
Fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XCAW_02966 (oLE1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XCAW_02966 (oLE1)
Enzymes [BR:xci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XCAW_02966 (oLE1)
Lipid biosynthesis proteins [BR:xci01004]
 Desaturase
  First
   XCAW_02966 (oLE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3311007..3312005
Genome map
AA seq 332 aa AA seqDB search
MPSTGLDPHAAAPQPATAPPRGGLAARVGSLRRWVDSQTDEPLDEARADRIDWLRAVPFI
ALHLACLAVFWVGASWFAVGMAVALYALRMFALTGFYHRYFSHRAFKTSRVLQFVFAAIG
ATCVQRGPLWWAAHHRNHHRHTDTGRDPHSPAQHGFWWSHTGWFLTPRNFRTDWEVIPDL
RRFAELRFLDRFDIVMPVLLALGLYLLGDWLAVAAPALKTSGAQLLVWGFVISTVALFHA
TFTINSLAHRFGSRRFDTRDDSRNNWLLALLTFGEGWHNNHHFFPGSARQGLRWWEYDMT
WYGLTAMSWVGLVWDLKPMPKLLTQRAERVKR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgccgagcactggcctggaccctcacgccgcagcgccgcagcccgccaccgcaccaccg
cgtggcgggctggccgcacgcgtcggcagcctgcggcgctgggtggattcgcaaaccgac
gagcccctggacgaagcgcgtgccgatcgcatcgactggctacgtgcggtgcctttcatc
gccttgcacctggcctgcctggcggtgttctgggtcggtgcgtcctggtttgcggtgggc
atggcggtggcgttgtacgcgctgcgcatgttcgcgctcaccggtttttaccaccgctac
ttctcgcaccgcgcgttcaagacgtcgcgggtgctgcaattcgtgttcgccgccatcggg
gccacctgcgtgcagcgcgggccgttgtggtgggcggcgcatcatcgcaaccaccatcga
cataccgacaccggccgcgatccgcattcgccggcgcagcacggcttctggtggagccat
accggctggttcctgaccccgcgtaatttccgcaccgactgggaagtgattcccgacctg
cgccgctttgccgaactgcgctttctggaccgcttcgacatcgtgatgccggtgctgctg
gcgctgggcctgtacctgctcggcgactggctggcagtggctgcgcccgcgctgaaaacc
agcggcgcgcagttgttggtgtggggctttgtgatctccaccgtggcgttgttccatgcc
accttcaccatcaactcgctggcgcatcgtttcggcagccggcggttcgacacccgcgac
gacagccgcaacaactggctgctggccttgctcaccttcggcgaaggctggcacaacaat
caccatttcttcccaggctcggcgcgccagggattgcgatggtgggaatacgacatgacc
tggtacggactcaccgcgatgtcgtgggtggggctggtgtgggacctcaagccgatgccg
aagctgctcacccagcgcgccgaacgggtgaagcgatga

DBGET integrated database retrieval system