KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_03007Help
Entry
XCAW_03007        CDS       T02519                                 

Gene name
cDC9
Definition
ATP-dependent DNA ligase
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:xci00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XCAW_03007 (cDC9)
   03410 Base excision repair
    XCAW_03007 (cDC9)
   03420 Nucleotide excision repair
    XCAW_03007 (cDC9)
   03430 Mismatch repair
    XCAW_03007 (cDC9)
Enzymes [BR:xci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XCAW_03007 (cDC9)
    6.5.1.6  DNA ligase (ATP or NAD+)
     XCAW_03007 (cDC9)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     XCAW_03007 (cDC9)
DNA replication proteins [BR:xci03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    Other elongation factors
     XCAW_03007 (cDC9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3349352..3350956
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYRTLDRATGTLDKRAALVAYFRDAPALDAAWALYLLAGGKVASARMRIASSGE
LREWITDTAGIADWLVADSYDHVGDLAETLALLLDDPVTETADLPLAQWIEQRLLPIANQ
DVDVRKACIVQAWRSLAFDERLAFNKLLTGALRVGVSQRLVQQALAELSGVDIARIAQRM
LGSWRPHPTYLAELLTSEELPGDRQQPYPFFLASPLEAEVETLGAIDDWLLEWKWDGIRL
QLIRRAGEAALWSRGEERLDGRFPEIEHAAMQLPDGTVIDGELLAWQPEQPLPMPFTALQ
TRIQRLKPGPKTLAAAPARVVAYDLLELAGEDLRERPLRERRALLEGVLFALADPRIVAS
PLVQVSDWQAAAHVRVEARERGVEGLMLKRASSMYQSGRRRGDWWKWKIDPLTIDAVLLY
AQAGHGRRSTLYTDYTFGLWHEGQLVPIAKAYSGLDDKEILQLDRWIRANTTERFGPVRA
VTAHHVFELGFEAVNRSARHKSGIAVRFPRILRWRHDKPMAEADHLSTLQALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtttcgcggcgttgtaccgcaccctggatcgcgccaccggtacgctcgacaag
cgcgcggcactggtcgcgtatttccgcgatgcacccgcgctggacgcggcatgggcgctg
tacctgctggccggtggcaaggtagccagcgcgcgcatgcgcattgccagcagcggcgag
ctgcgcgaatggatcaccgataccgccggcattgccgactggctggtcgccgacagctac
gaccatgtcggcgatctggccgaaaccctggccttgctgctggacgacccggtcaccgag
acggccgacctgcccctggcccagtggatcgaacagcgcctactgcccatcgcaaatcag
gacgtggacgtgcgcaaggcctgcatcgtgcaggcatggcgcagcctggccttcgacgag
cgtctggcattcaacaagctgctgaccggcgcgctgcgcgtgggcgtgtcgcagcgactc
gtgcagcaggcgctggccgaattgtcgggcgtggatatcgcgcgcatcgcgcagcgcatg
ctcggcagttggcggccgcatccaacctatcttgcagagctgttgaccagcgaagaactg
cctggcgatcgccagcagccttacccgttcttcctggcatcgccgctggaggcggaggtc
gagacgctgggcgccatcgatgactggctgctggaatggaaatgggacggcattcgcctg
caactgattcgccgcgccggcgaagcggcgctgtggtcgcgcggcgaagaacgtctggat
ggacgttttcctgaaatcgaacacgccgcaatgcaattgccggacggcaccgtcatcgat
ggcgagctgctggcctggcaacccgaacagcccctgccaatgccgtttaccgcgttgcag
acgcgcatccagcggctcaagcccgggcccaagaccttagccgccgcaccggcgcgcgtg
gtggcctacgacctactggaattggcaggcgaagacctgcgcgagcgcccgctacgggag
cggcgcgcactgctggaaggcgtgctcttcgcgctcgcagatccgcgcatcgtcgcgtcg
ccgctggtgcaggtcagcgattggcaggccgcagcgcacgtgcgggtggaagcgcgcgaa
cgcggcgtggaagggctgatgctcaagcgcgccagttcgatgtatcagtccggtcgccgt
cgcggcgactggtggaaatggaagatcgacccgctaaccatcgacgcggtgctgttgtac
gcgcaagccggccacggccgacgcagcacgctctacaccgactacaccttcgggctgtgg
catgagggccaactggtgccgatcgccaaggcgtattcgggcctggacgacaaggaaatc
ctgcagctggatcgctggatccgcgccaacaccaccgagcgcttcggcccggtgcgcgcg
gtcacggcgcatcatgtattcgagctggggtttgaagcggtgaaccgcagcgcgcggcac
aaatccggcatcgcagtgcgcttcccgcgcatcctgcgctggcgtcacgacaagccgatg
gccgaagccgatcatctgagcaccctgcaggcactggcgcggtga

DBGET integrated database retrieval system