KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_03136Help
Entry
XCAW_03136        CDS       T02519                                 

Definition
Hypothetical Protein
Orthology
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Brite
Enzymes [BR:xci01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XCAW_03136
Peptidases [BR:xci01002]
 Metallo Peptidases
  Family M2
   XCAW_03136
Exosome [BR:xci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCAW_03136
Cellular antigens [BR:xci04090]
 Proteins
  XCAW_03136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3501963..3503981
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVATGTLSLSACRRDAAPPDKPVATKTAPAESADQFVARISAEYKAAYPE
TTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTAQPMRKDYQRFVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNASGDGGAAARFNAEREAQLRTAKQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEASQNIGADVRTKMCIKPTEEDFT
TIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQTGR
ESLINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEEFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSDWLKQQNQGQMCGWQATAAA
PVTTKTAPAAAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcattggctgtggctaccggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccaccggacaaacctgtcgcgaccaagaccgcgccggcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaggcggcctatccggaa
accaccgctgcgcagtggctgtcgtccacctatatcaacggcgattcgcagttgctggcg
gccaaggccaacgaacgctcgctggcgcagctggatcggtggatcgaacaatccaagcag
tacgccggcacaccgatgtcggccgacagtgcgcgtgcgctgcagttgctcaaattgatg
agcgccctgcccgcaccgcgcgaccctgccaagctggccgaactcacccgcatcgccgcc
aagatggaaggcgattacggcgccggcagctattgcgtgggcgaaggcgagcagcgccgc
tgccgccagctgggcgagttggagcaagtgctggccagcagccgcgactacaacgagcaa
ctcgacgcatggcagggctggcacagcactgcgcaacccatgcgcaaggactaccaacgc
ttcgtcgagctggccaatgagggcgcacgcgggctgggtttcgccgacgtcggggtgcta
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgcctatgg
gaacaggtcaaaccgttgtatgcgcagttgcagtgctatgcgcgcggcaaactcgacacg
caatacggcaaagacaagggcgaggtcgccggcggcctgttgccggcacatctgatgggc
aatatgtggcagcaggactggagcaatctgtgggatctgctgcagccctacccgggggcc
ggcgatctggacatcacctccgcgctggaaaagcagtaccagggcaacctcaccgcagtg
ctggcacgcaacgccagtggcgatggtggcgcggccgcacgcttcaacgccgaacgcgaa
gcgcagctgcgcaccgccaagcagatgaccgaacgcgcgcaggatttctacacatcgctg
ggcatgcccaagctgccggacacctattggcagcgctcgcagttcatcaagccgctggac
cgcgacgtggtgtgccacgccagcgcctgggacatgaacatgggcggcgaggcgagccag
aacatcggcgcggatgtgcgcaccaagatgtgcatcaaaccgaccgaagaagacttcacc
accatctaccacgagctgggccacatctattacgacctggcctacaacccgttaccgccg
ctgttccagaacggcgccaacgatggcttccacgaagcgatcggcgacaccatcgtgctg
gcgatgacgcccaaatacctgcaatcgatcggcatggtgggcgagcaacagaccggccgc
gagtcgttgatcaattcgcagatgcgcatggcgctgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgacggctccatcacgcccgagcat
tacaaccaggcctggtgggaactcaaagccaagtaccagggcgtggcgccggtgagcgcg
cgcggcgaagaattcttcgaccctggcgccaagtaccacgtgccgggcaacaccccgtac
acgcgttattttctggcgcatatcctgcaattccagttctacaaaggcctgtgccaggcc
gccggccatcaggggccgctgtacgagtgcagcttctacggcaacaaggacgccgggcag
aagttctggtcgatgctgcaacgtggttccagccaaccctggcaaaccacactcaaggaa
ctcaccggcaacgacaaactcgatgccggcccgatgctggaatacttcgcgccgatgagc
gactggctgaagcagcagaaccaggggcagatgtgcgggtggcaggcaacggctgccgct
ccggttacaacgaaaactgcgcctgctgcagctcgttga

DBGET integrated database retrieval system