KEGG   Xanthomonas citri: XCAW_03969Help
Entry
XCAW_03969        CDS       T02519                                 

Gene name
bglC
Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCAW_03969 (bglC)
Enzymes [BR:xci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XCAW_03969 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4444957..4446381
Genome map
AA seq 474 aa AA seqDB search
MSIFRAASTLALATMLALTSAPAFSYSVSNNKIVDDNGNVVQLKGVNVFGFETGNHVMHG
LWARNWKEMINQMQGLGFNAVRLPFCPATLRSGQMPSSIDYSRNADLQGLTSLQILDKVI
NEFNARGMYVLLDHHTPDCGAISELWYTSSYSEAQWLDDLRFVANRYKNVPSVIGVDLKN
EPHGAATWGTGNAATDWNTAAERGSAAVLAVAPKWIIAVEGITDNPVCSTNGGIFWGGNL
QPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWDRHFGQFAGSHALLL
GEFGGKYGEGDARDKVWQDALVKYLRSKGINEGFYWSWNPNSGDTGGILRDDWTSVREDK
MTLLRTLWGTVSNSTPTPTPTPTPTPTPTPSAGFGTKVIPDSTWNGGYCNRVQVTNTGTA
SGNWSISLTVTGTVNNAWNVTWSQSGTTLQASGVDYNRTLAPGATAEFGFCAAG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttcagggctgcaagtacgctcgcattggcaacgatgttagcgctcacctcc
gcaccggctttcagctattcggtcagcaataacaagatcgtcgacgacaacggcaatgtg
gttcagctcaagggcgtcaacgtgttcggcttcgagaccggcaaccatgtcatgcatggt
ctgtgggcacgcaactggaaagagatgatcaaccagatgcagggcctgggcttcaacgcg
gtgcgcctgccattctgcccggccacgctgcgtagcggccagatgcccagcagcatcgac
tacagccgtaacgccgatctgcagggcctgacctcgctgcagatcctcgacaaggtgatc
aacgaattcaacgcacgcggcatgtatgtgctgctggatcaccacacgcccgattgcggc
gcgatttccgagctgtggtacaccagttcgtattccgaagcgcaatggctggatgatctg
cgctttgtcgccaatcgttacaagaacgtgccgagcgtgatcggcgtggatctgaagaac
gagccgcacggcgccgcgacctggggcacgggtaacgccgccaccgactggaacacggcc
gccgagcgcggttctgccgctgtgcttgcggtggcgccgaaatggatcatcgcggtggaa
ggcatcaccgacaacccggtatgttcgaccaacggcggcatcttctggggtggcaacctg
cagccgctggcctgcaccccattgaacattccggccaaccgcctgttgctggcaccgcat
gtgtacggcccggacgtgttcgtgcagtcgtacttcaacgacagcaacttccccaacaac
atgcccgcgatctgggaccgccatttcggccagttcgccggcagtcacgcgctgctgctg
ggcgaattcggcggcaaatacggcgaaggcgatgcgcgcgacaaggtgtggcaggacgcg
ctggtgaagtacctgcgcagcaagggcatcaacgaaggattctattggtcgtggaacccc
aatagcggcgataccggcggcatcctgcgcgacgactggaccagcgtacgcgaggacaag
atgaccttgttgcggacgctgtggggaacggtgagcaacagcacaccgacgccaacgccg
acccccacgccgacgccaaccccaacaccaagcgcgggcttcggtaccaaggtcatcccg
gacagcacctggaacggtggctactgcaaccgcgtgcaggtcaccaacaccggcaccgcc
agcggcaattggtcgatctcgctgacagtcaccggcaccgtcaacaacgcctggaacgtc
acctggtcacagagcggcaccacgctccaggccagcggcgtggactacaaccgcacgctg
gcgcccggtgcaactgccgagttcggcttctgcgcagcaggttga

DBGET integrated database retrieval system