KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_04191Help
Entry
XCAW_04191        CDS       T02519                                 

Gene name
avtA
Definition
PLP-dependent aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    XCAW_04191 (avtA)
   01230 Biosynthesis of amino acids
    XCAW_04191 (avtA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XCAW_04191 (avtA)
   00290 Valine, leucine and isoleucine biosynthesis
    XCAW_04191 (avtA)
Enzymes [BR:xci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XCAW_04191 (avtA)
    2.6.1.66  valine---pyruvate transaminase
     XCAW_04191 (avtA)
Amino acid related enzymes [BR:xci01007]
 Aminotransferase (transaminase)
  Class I
   XCAW_04191 (avtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4717330..4718601
Genome map
AA seq 423 aa AA seqDB search
MSTAPQKPLAIRERLSEVRYEIRGELARRARELEAQGRKLIKLNIGNPGAFGFRAPEHLQ
RAIADDMGRTDPYTHQQGLPEAREAIATAYARRQHPDAHPDRIFVGNGVSELIDLSLRAL
LNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCAPENGFQPDPVEIETLVSSRTRAIVLI
NPNNPSGASYSRELLERIVAIATKHNLLLMVDEIYDQVLYDDAAFVPVAPLAGAHPCITF
SGLSKVHRACGWRVGWALLSGDQARINDLRNAMDLLGALRLCANVPGQYAIDAAVNGPDT
ISALCAPGGRLYETRRAVIEACAASEHLSLVAPAGALYAFPAVVGAAARNFDDHAFALDL
MNEEGVLVVPGSSFNVPYRHHFRVTLMPEAGVMRDVFARIDRALARRAEAVTKVVPLKPR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccccgcaaaagccgctcgccatccgcgagcgtctgtccgaagtccgctac
gaaatccggggcgagctggcgcgacgagcgcgggagctggaggcgcagggccgcaagctg
atcaagctcaatatcggtaacccgggtgcgttcggcttccgtgcgccggagcatctgcag
cgcgccatcgccgacgacatgggccgcaccgatccgtacacccatcagcaaggcctgccg
gaagcgcgcgaggcgatcgccaccgcatatgcgcggcgccagcatccggatgcgcatccg
gaccgcatcttcgttggcaacggcgtcagcgaactgatcgatctgtcgctgcgtgcgctg
ctcaatcccggcgacgaagtgctggtgccctcgcccgactatccgctgtggtcggccgcg
accatcctcaacgatggtcgtcccgtgtattaccgctgcgccccggaaaacggcttccag
ccggacccagtggagatcgagacgctggtgtcctcgcgcacccgcgccatcgtgctgatc
aatccaaacaatcccagcggcgccagttattcgcgcgaactgctggagcgcatcgtggcg
atcgccaccaagcacaatctgctcttgatggtcgatgagatctacgaccaggtgctgtac
gacgacgcggccttcgtgccggtcgcgccgctggccggcgcgcacccgtgcatcactttc
agcggcctgagcaaggtgcatcgcgcctgcggttggcgcgtgggctgggcactgctgtcg
ggcgaccaagcgcgcatcaacgacttgcgcaatgcgatggacctgctcggcgccttgcgc
ctgtgcgccaatgtaccaggccagtacgccatcgatgcggccgtgaacgggccggacacc
atctcggcattgtgcgcacccggcggacggctgtacgaaacccgccgcgcggtgatcgag
gcctgcgcggccagcgagcatctgtcgctggtggcaccggccggtgcgctgtatgcgttc
ccggcagtggtgggcgcggcggcgcgcaacttcgacgatcatgcgttcgccctcgatctg
atgaacgaggaaggcgtgctggtggttcccggctccagcttcaacgtgccgtatcgccat
catttccgcgtgacattgatgccggaagccggtgtgatgcgcgatgtgttcgcgcgcatc
gaccgtgcactggcacgccgcgccgaagcggtcaccaaggtggttccactcaagccacgc
agcgtggcctga

DBGET integrated database retrieval system