KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_04214Help
Entry
XCAW_04214        CDS       T02519                                 

Gene name
celA
Definition
(GenBank) Cellulase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4742289..4743470)
Genome map
AA seq 393 aa AA seqDB search
MSAHAHTGGMTRRRLLHAGTLAGVAALLPAAALAAPSQCGPWPLWSAFVDKHIQRDGRVV
DFLNPDQRSTSEGQSYALFFALVNNDQVLFDKVLSWTRHNLCGGRPDLNLPAWLWGRDGS
GAWRVLDANTASDGELWIAYALLEAGRLWSRPGFLKAGQQMLQLIRTQEVATLPGLGPML
LPGRTGFVDNGRWTLNPSYLPIQVLRRCANADPKGPWAAIAANSARVLRDSAPVGFAPDW
TVWDGKTFNADPKRGNVGSYDAIRVYLWAGMLDAGEPLRARLLQDLSGPADLLAAQQTPA
EKIDTARGVGTGALPVGFSAALLPYLSALGKPALLKAQAQRVPAATQPAAAALPYFERTL
ALFGQGWLENRYRFAADGRLLPAWRTPACAATT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcacgcacataccggtggcatgacgcgccgtcgcctgctgcatgcaggcaca
ttggcgggcgtggccgcgctgctgccggcagccgcgctggcggcgcccagccagtgcggg
ccgtggccgctgtggagcgccttcgtcgacaagcacatccagcgcgatgggcgggtggtg
gattttctcaatcccgatcaacgctccacctcggaagggcagtcgtatgcgctgttcttc
gccctggtcaacaacgatcaggtgctgttcgacaaggtgctgagctggacccgccacaac
ctgtgcggcggccgcccggatctcaacctgccggcatggctgtggggccgcgatggcagc
ggcgcctggcgcgtgctggacgccaacaccgccagcgatggcgagttgtggattgcctat
gcgctgctggaagccggcaggttgtggagccgcccgggctttctcaaggccggccagcag
atgctgcagctgatccgcacgcaggaagtggccacgctgcccgggttgggcccgatgctg
ctgccgggccgcaccggcttcgtcgacaacgggcgctggacgctcaatcccagctatcta
cccatccaggtgctgcgtcgttgcgccaacgccgaccccaagggcccatgggccgccatc
gccgccaacagcgcgcgcgtgctgcgcgacagtgcgccggtggggtttgccccggattgg
acggtgtgggacggcaagaccttcaatgccgatcccaagcgcggcaatgtgggcagttac
gacgccatccgcgtgtacctgtgggccggcatgctggacgctggcgagccgctgcgcgcg
cggttgctgcaggacctgtccggaccggccgacctgctcgccgcgcagcagacgccggcc
gaaaagatcgacaccgcgcgcggtgtgggcaccggcgcgctgccggtgggattttctgcg
gcgttgttgccgtacctgagcgcgctgggcaagcccgcgctgctcaaggcgcaggcgcag
cgggtgcccgccgccacgcagccggccgccgctgccttgccgtatttcgaacgcacgctg
gccctgttcggacagggatggcttgagaaccgctaccgcttcgccgcagacgggcgcctg
ttgcccgcctggagaacccctgcatgcgccgcaacgacctga

DBGET integrated database retrieval system