KEGG   Xanthomonas citri: XCAW_04248Help
Entry
XCAW_04248        CDS       T02519                                 

Gene name
dsbG
Definition
Protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Brite
Enzymes [BR:xci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XCAW_04248 (dsbG)
Secretion system [BR:xci02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XCAW_04248 (dsbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4795028..4795831)
Genome map
AA seq 267 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASTAGAKPAAAPAATGTGTVDQRVSTALKALDPDF
KPDYIGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLD
TVPKADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQ
DHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYNLGQRLGVNGTPAIFAPDGT
QLGGYLPPAQLREALEKRAVSTAGGSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcgctgctgggcgcgatcagccttaccgcctgcgcacaa
tcctcgcagcctgcggcaagcactgccggcgccaagccagccgctgcgcccgccgctacc
ggcaccggcaccgtggaccagcgcgtgagcacggcgctcaaggcgctggacccggatttc
aaacccgattacatcggcgctgcgccgttccccggctttcgcgaagtggtcgtcggcggg
caggtgctgtacgtcagcgacgacggtcgttacctgatccaggcgcagccgttcgacatc
cagaacaagcagttcgccgccagcccgggcttgctggcctaccgccgcaagcagctggac
accgtgcccaaggccgaccgcatcgtgttcgcgccggccaacccgaagtacaccgtcacc
gtcttcaccgatgtggagtgcggttactgccgtaagttgcatagcgagatcggcgagctc
aacaagcagggcatcgcggtggaatacctggcgttcccgcgcatgggcctgggcagccag
gaccataaggaaatgattgcggtgtggtgcgctgccgatcgcaagcaggcgctcacggcc
gccaagtcgggtcagccggtcgcctccaaggactgcaagaacccggtgtcgatggaatac
aacctgggccagcgcctgggcgtcaacggaacgccggcgatcttcgcccccgacggcacc
cagctcggtggctacctgccgccagcccagttgcgtgaggcgctggaaaagcgtgccgtg
agcacggcgggcggcagccgctga

DBGET integrated database retrieval system