KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_04670Help
Entry
XCAW_04670        CDS       T02519                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XCAW_04670 (folE)
Enzymes [BR:xci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     XCAW_04670 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5234144..5234746)
Genome map
AA seq 200 aa AA seqDB search
MSQSNQPDSPVTQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRDEPRE
YLERTFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVES
YARRFQVQEKMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSF
REDARTRAEFLQFIEVGGKR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtccaaccagcccgattcccccgtgacccagacccaggccgaagaggccgtg
cgcaccctgttgcgctgggcgggcgaagatcccacgcgtgagggcctgctggacacaccg
cgccgggtggccgaagcctacggcgactggttcagcggctatcgggacgaaccgcgcgaa
tacctggaacgcacgttcgaggaagtggccggctacgacgagttgatcgtgctgcgcgac
atttcctacgaaagccattgcgagcaccacatggcgccgatcatcggcaaggtgcacgtg
ggctatctgccgcgtggcaaggtcgtcggcatcagcaagctggcgcgcgtggtggaaagc
tatgcgcgccgcttccaggtgcaggaaaagatgaccgcgcagatcgcccaatgcatccag
gacgtgctgcagccgcttggcgtgggcgtggtggtggaaggcgcgcacgagtgcatgacc
acccgcggcatccacaagcgcggcgtcagcatggtgacctccaagatgctgggcagcttc
cgcgaggacgcgcgcacccgcgccgaattcctgcagttcatcgaagtgggcggcaagcgt
tga

DBGET integrated database retrieval system