KEGG   Xanthomonas campestris pv. raphani: XCR_0033Help
Entry
XCR_0033          CDS       T01872                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31555..32574)
Genome map
AA seq 339 aa AA seqDB search
MSCAVFFLLLGVLPMGHAQTRALKYAGVNLAGAEFASSKKPGVLNKDYMYPASTDYSYFA
GTGMNVIRLPILWERLQPAARGELDPAQLALVQQAVARAKASGMYLVLDIHNYSKYYGYK
VGGPEVPLATFADLWRRLAVIFNSDNAVIFGLMNEPNNISASEWAGAAQAGIDAIRATGA
NNLILVPGALWTGAHSWHSLTSDGYSNATALASISDPLNRYAFEVHQYLDADSSGTSSVC
VSETIGADRLRAFTEWLRTNNKRGFLGEFGTANNAVCNTALQGMLAYMENNADVWLGWTW
WAAGAWWNTSYAYNVHPNKDGTDKPQMTILSPQAARATR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgcgcggtgttcttcctgctgctcggtgtcctgccgatgggccatgcacaaacg
cgtgcactcaagtacgccggcgtcaatttggcgggtgcggaattcgcgtcatcgaaaaag
cctggcgtcctcaacaaggactacatgtatcccgccagcactgattacagctatttcgct
ggcactggaatgaacgtgattcgcctgccgatcctgtgggaacgtctgcaacctgccgca
cgcggcgagctggatccggcgcagctggcattggtgcagcaagcggtggcacgcgccaag
gcatcgggcatgtatctggtgctggatatccacaactacagcaagtactacggttataaa
gtgggtgggccggaagtgccgctcgccacctttgccgatctgtggcggcgcctggcggtg
atcttcaacagcgataacgccgtgatcttcgggctgatgaatgagcccaacaacatctct
gccagcgaatgggccggtgcagcgcaggcaggcatcgatgcgatccgtgccaccggcgcc
aacaatctgatcctggtcccgggcgcgctgtggaccggcgcacacagctggcactcgctg
accagcgatgggtattccaatgcaaccgcgttggcatcgatcagcgacccactcaatcgc
tatgcgttcgaagtgcatcaatatctggatgccgattccagcggcacctccagtgtctgc
gtcagtgaaaccatcggcgccgatcgcctgcgtgccttcaccgaatggctgcgcaccaac
aacaagcgtggctttctcggtgagttcggtaccgccaacaacgccgtctgcaataccgcg
ctgcaaggcatgctggcctacatggaaaacaacgccgatgtctggctgggctggacatgg
tgggcagcgggcgcatggtggaacaccagctacgcctacaacgtgcatccgaacaaggac
ggcaccgacaagccgcagatgaccatcctctcgccgcaggccgcgcgcgctacacgctga

DBGET integrated database retrieval system