KEGG   Xanthomonas campestris pv. raphani: XCR_0034Help
Entry
XCR_0034          CDS       T01872                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(33013..34065)
Genome map
AA seq 350 aa AA seqDB search
MSASPSWPRQLLRCALVMLCIATMSIAQAQSPNRLKYAGVNISGAEIQSSKKPGVLNIDY
RYPTASEYRYFAGKQMNIVRLPILWERMQPKAQGPLDPAQLALLKQAVANAKAANQYLII
DVHNYAKYYGQKIGSKPVPVRTFTDLWRRLAIAFKSDNAVIFGLMNEPYDISPESWAAAA
QASIDSIRATGATNLILVPGALWSGAHSWYSTVAGQSNAVALANIRDPLNRYAIEVHQYL
DTDSSGTSAGCVSRTIGAERLRSFTGWLRAQGKRGFLGEFGTANNATCTAALDGMLGYLE
TNHDVWIGWTFWAAGAWWKTSYPFNVQPDAQGRDKPQMKTLSARAHRVTR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctccccctcctggccacgccagctgctgcgctgcgcgttggtcatgctgtgc
atcgccacgatgtccatcgcacaggcgcaaagccccaatcgtctgaaatacgcaggcgtc
aacatctccggtgcggagatccagtcgtccaaaaaaccgggcgtgctcaatatcgactac
cgctatccaaccgcgtccgagtacaggtacttcgcgggcaagcagatgaacatcgtgcgc
ctgccgatcctgtgggagcgcatgcagcccaaagcccagggtccgctggatccggcacaa
ctggcattgctgaagcaggcagtggccaacgccaaggccgccaatcaatacctgattatc
gatgtgcacaactacgccaagtactacggccagaagattggcagtaagccggtgccggtg
cgcacgttcaccgacctctggcgccgcctggccatcgcattcaagagcgacaacgccgtg
atcttcgggctgatgaacgagccgtacgacatctcgccagagagttgggccgccgccgcg
caggcgtccatcgacagcattcgtgccaccggtgccaccaacctgattctggtgcccggt
gcattgtggtcgggcgcacatagctggtattccaccgtggccgggcagtccaatgcagtg
gcgcttgcgaacatccgcgacccactgaatcgctatgcgattgaagtccatcaatacctg
gacaccgactccagcggcaccagtgccggttgtgtgagccgcacgatcggtgcggagcgc
ttgcgcagtttcaccggctggctgcgcgcgcaaggcaagcgcggttttcttggcgaattc
ggcaccgccaataacgcaacctgcactgcggcgctggacggcatgctcggttatctcgaa
accaaccacgatgtgtggatcggttggacgttctgggcggcgggcgcgtggtggaaaacc
agctatccgttcaacgtgcagcccgatgcgcaaggccgcgacaagccgcagatgaaaacc
ttgagcgcacgcgcgcatcgcgtcacccgctaa

DBGET integrated database retrieval system