KEGG   Xanthomonas campestris pv. raphani: XCR_0141Help
Entry
XCR_0141          CDS       T01872                                 

Definition
pectinesterase superfamily
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xcp00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153069..154046
Genome map
AA seq 325 aa AA seqDB search
MQPHRRIVLRTLAAAALLAGLSLGSNAAIAADPVYTVAKQGSAGYRTVQAAIDAAVQGGK
RAQINIGAGTYQELIVVPSNAPALKLTGAGATQTVITYDNYAARINPATGAAYGTSGSSS
VIIAGNDFTAEQLSFGNHAGPVGQAVAVRVDGDRAAFRNVRFLGYQDTLYLRGAKLSYFL
DCYVEGTVDFVFGAGTALFENVQLHSLGDGYLTAASTPQESARGFVFRNARITAASGVSR
VFLGRPWRPYASVSFITSQLGAHIVPEGWNNWGNAANEATARYSEYQNTGAGANPSRRVK
WSRQLTAAQAAALDRSTVLGSWRPF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgcatcgcaggatcgtgttacgtactctcgctgccgccgccttgctggcgggc
ctttcgctcggcagcaacgctgccatcgccgccgacccggtctacaccgtggccaagcag
ggcagcgccggctaccgcaccgtgcaggccgccatcgacgccgccgtacagggcggcaaa
cgcgcgcagatcaatatcggcgccggcacctatcaggaactgatcgtggtgccgtccaac
gcaccggcgctcaagctcaccggcgcgggcgccacccaaaccgtcatcacctacgacaac
tacgccgcgcgcatcaatccggccaccggcgctgcgtacggcacctccggctcgtccagc
gtcatcatcgccggcaatgacttcaccgccgagcaactgagcttcggcaaccacgcaggc
ccggtggggcaggcggtggcggtgcgcgtggatggcgaccgcgcggcgttccgcaatgtg
cgtttcctcggctaccaggacacgctgtacctgcgcggcgccaagctctcgtatttcctc
gactgctatgtcgaaggcaccgtggatttcgtcttcggcgccggcactgccctgttcgaa
aacgtgcagctgcattcgctgggcgatggctatctcaccgctgcttccacgccgcaggag
agcgcacgcggctttgtgtttcgcaatgcacgcatcaccgccgccagcggtgtctcgcgc
gtgttcctgggccggccgtggcggccgtacgccagcgtgagtttcatcactagccagctc
ggcgcgcacatcgtgcccgagggctggaacaactggggcaacgcggccaacgaggccacc
gcccgctacagcgaataccagaacaccggcgccggggccaacccgtcgcgccgcgtgaaa
tggtcacgccagctcaccgccgcacaggccgctgcgctggaccgctccaccgtgctgggc
tcctggaggccgttctga

DBGET integrated database retrieval system