KEGG   Xanthomonas campestris pv. raphani: XCR_0316Help
Entry
XCR_0316          CDS       T01872                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XCR_0316 (hemB)
Enzymes [BR:xcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     XCR_0316 (hemB)
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCR_0316 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359873..360862
Genome map
AA seq 329 aa AA seqDB search
MAHPHYRPRRMRHDAFSRRLMRENTLTTDDLIWPVFVHELPGRAPIASMPGVERLSLDEL
LREAENALELGIPVIDLFPVIDPAGKSLDAAEAWNPDGLAQRAVRALKARFPELGIMTDV
ALDPYTTHGQDGLIDAKGYVLNEITVEALVKQSLSHAQAGVDIISPSDMMDGRIGAIRRA
LDAEDHLNVRIMAYSAKYASAFYGPFRDAVGSAGNLGKADKTTYQMDPANSDEAMREIAL
DLEEGADMVMVKPGMPYLDVVRRVKEEFRVPTFAYQVSGEYAMLKAASANGWLDERKCVL
EALMAFKRAGADGVLTYFAPQVARWLREG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcccacccccactaccgtccacgtcgtatgcgccacgatgcgttttcgcgccgattg
atgcgcgagaacacgttgaccaccgacgatctgatctggccggtgttcgtacatgagttg
ccagggcgcgcgccgattgcctcgatgcccggcgtcgaacgtctgtcgctggacgagttg
ctgcgcgaggcggaaaacgcgctggaactgggcatcccggtgatcgatctgttcccggtg
atcgacccggccggcaagagcctggacgcggccgaagcctggaatccggacggcctggcg
cagcgtgcagtgcgcgccctcaaggcgcgctttcccgagctgggcatcatgaccgacgtg
gcgctggacccgtacaccacccacggccaggacggtttgatcgacgccaagggttatgta
ctcaacgagatcaccgtcgaagcgctggtgaagcaatcgctgtcgcatgcgcaggcgggc
gtggacatcatttcgccctcggacatgatggacgggcgcatcggtgcgatccgccgcgcg
ctggatgccgaggaccatctcaacgtgcgcatcatggcgtattcggccaagtacgcctcc
gcgttctacggcccgtttcgcgatgcggtgggcagcgccggcaatctcggcaaggccgac
aagaccacgtatcagatggacccggccaacagcgacgaggccatgcgcgagatcgcgctg
gacctggaagagggtgcggacatggtgatggtcaagccgggcatgccgtatctggatgtg
gtgcggcgggtcaaggaagagttccgcgtgccgaccttcgcttaccaggtcagcggcgag
tacgcgatgttgaaggccgccagcgccaatggctggctggacgaacgcaagtgcgtgctg
gaagcgctgatggcgttcaagcgcgccggtgctgatggcgtgctgacctacttcgcgccg
caagtggcgcgctggctgcgcgagggctaa

DBGET integrated database retrieval system